Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CLD04_RS12940 Genome accession   NZ_CP023257
Coordinates   2423659..2423832 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain TLO3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2418659..2428832
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLD04_RS12925 (CLD04_12925) gcvT 2419459..2420547 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  CLD04_RS12930 (CLD04_12930) hepAA 2420988..2422661 (+) 1674 WP_017696203.1 SNF2-related protein -
  CLD04_RS12935 (CLD04_12935) yqhG 2422682..2423476 (+) 795 WP_017696202.1 YqhG family protein -
  CLD04_RS12940 (CLD04_12940) sinI 2423659..2423832 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  CLD04_RS12945 (CLD04_12945) sinR 2423866..2424201 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CLD04_RS12950 (CLD04_12950) tasA 2424294..2425079 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  CLD04_RS12955 (CLD04_12955) sipW 2425144..2425716 (-) 573 WP_072557060.1 signal peptidase I SipW -
  CLD04_RS12960 (CLD04_12960) tapA 2425700..2426455 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  CLD04_RS12965 (CLD04_12965) yqzG 2426726..2427052 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  CLD04_RS12970 (CLD04_12970) spoIITA 2427094..2427273 (-) 180 WP_014480252.1 YqzE family protein -
  CLD04_RS12975 (CLD04_12975) comGG 2427344..2427718 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  CLD04_RS12980 (CLD04_12980) comGF 2427719..2428102 (-) 384 WP_041334965.1 ComG operon protein ComGF Machinery gene
  CLD04_RS12985 (CLD04_12985) comGE 2428128..2428475 (-) 348 WP_041334967.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=245548 CLD04_RS12940 WP_003230187.1 2423659..2423832(+) (sinI) [Bacillus subtilis strain TLO3]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=245548 CLD04_RS12940 WP_003230187.1 2423659..2423832(+) (sinI) [Bacillus subtilis strain TLO3]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment