Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | CK945_RS18485 | Genome accession | NZ_CP023168 |
| Coordinates | 3555330..3555470 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | P69890 |
| Organism | Bacillus paralicheniformis strain 14DA11 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3550330..3560470
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CK945_RS18460 | - | 3550623..3551012 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| CK945_RS18465 | comA | 3551029..3551667 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| CK945_RS18470 | comP | 3551754..3554069 (-) | 2316 | WP_035337589.1 | sensor histidine kinase | Regulator |
| CK945_RS18475 | comX | 3554090..3554260 (-) | 171 | WP_020452790.1 | competence pheromone ComX | - |
| CK945_RS18480 | - | 3554232..3555143 (-) | 912 | WP_035337591.1 | polyprenyl synthetase family protein | - |
| CK945_RS18485 | degQ | 3555330..3555470 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| CK945_RS18495 | - | 3555956..3556303 (+) | 348 | WP_223254849.1 | hypothetical protein | - |
| CK945_RS18500 | - | 3556346..3557566 (-) | 1221 | WP_035337594.1 | EAL and HDOD domain-containing protein | - |
| CK945_RS18505 | - | 3557744..3559213 (-) | 1470 | WP_023856157.1 | nicotinate phosphoribosyltransferase | - |
| CK945_RS18510 | - | 3559231..3559782 (-) | 552 | WP_020452795.1 | cysteine hydrolase family protein | - |
| CK945_RS18515 | - | 3559968..3560369 (-) | 402 | WP_026580054.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=245131 CK945_RS18485 WP_003184860.1 3555330..3555470(-) (degQ) [Bacillus paralicheniformis strain 14DA11]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=245131 CK945_RS18485 WP_003184860.1 3555330..3555470(-) (degQ) [Bacillus paralicheniformis strain 14DA11]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |