Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CK945_RS18485 Genome accession   NZ_CP023168
Coordinates   3555330..3555470 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain 14DA11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3550330..3560470
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CK945_RS18460 - 3550623..3551012 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  CK945_RS18465 comA 3551029..3551667 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  CK945_RS18470 comP 3551754..3554069 (-) 2316 WP_035337589.1 sensor histidine kinase Regulator
  CK945_RS18475 comX 3554090..3554260 (-) 171 WP_020452790.1 competence pheromone ComX -
  CK945_RS18480 - 3554232..3555143 (-) 912 WP_035337591.1 polyprenyl synthetase family protein -
  CK945_RS18485 degQ 3555330..3555470 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  CK945_RS18495 - 3555956..3556303 (+) 348 WP_223254849.1 hypothetical protein -
  CK945_RS18500 - 3556346..3557566 (-) 1221 WP_035337594.1 EAL and HDOD domain-containing protein -
  CK945_RS18505 - 3557744..3559213 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  CK945_RS18510 - 3559231..3559782 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  CK945_RS18515 - 3559968..3560369 (-) 402 WP_026580054.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=245131 CK945_RS18485 WP_003184860.1 3555330..3555470(-) (degQ) [Bacillus paralicheniformis strain 14DA11]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=245131 CK945_RS18485 WP_003184860.1 3555330..3555470(-) (degQ) [Bacillus paralicheniformis strain 14DA11]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment