Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CK238_RS15585 Genome accession   NZ_CP023075
Coordinates   3084220..3084360 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain K26     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3079220..3089360
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CK238_RS15560 (CK238_15575) - 3079517..3079900 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  CK238_RS15565 (CK238_15580) comA 3079922..3080566 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  CK238_RS15570 (CK238_15585) comP 3080647..3082950 (-) 2304 WP_063637045.1 histidine kinase Regulator
  CK238_RS15575 (CK238_15590) comX 3082970..3083149 (-) 180 WP_318010531.1 competence pheromone ComX -
  CK238_RS15580 (CK238_15595) comQ 3083103..3084089 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  CK238_RS15585 (CK238_15600) degQ 3084220..3084360 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CK238_RS15595 (CK238_15610) - 3084825..3085166 (+) 342 WP_014418765.1 hypothetical protein -
  CK238_RS15600 (CK238_15615) - 3085173..3086396 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  CK238_RS15605 (CK238_15620) - 3086526..3087992 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CK238_RS15610 (CK238_15625) - 3088010..3088561 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  CK238_RS15615 (CK238_15630) - 3088658..3089056 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=244796 CK238_RS15585 WP_003152043.1 3084220..3084360(-) (degQ) [Bacillus velezensis strain K26]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=244796 CK238_RS15585 WP_003152043.1 3084220..3084360(-) (degQ) [Bacillus velezensis strain K26]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment