Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   CK238_RS02015 Genome accession   NZ_CP023075
Coordinates   396302..396421 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain K26     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 391302..401421
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CK238_RS02000 (CK238_01990) - 392914..393597 (+) 684 WP_014416901.1 response regulator transcription factor -
  CK238_RS02005 (CK238_01995) - 393584..395011 (+) 1428 WP_103527150.1 HAMP domain-containing sensor histidine kinase -
  CK238_RS02010 (CK238_02000) rapC 395170..396318 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  CK238_RS02015 (CK238_02005) phrC 396302..396421 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CK238_RS02020 (CK238_02010) - 396571..396666 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  CK238_RS02025 (CK238_02015) - 396761..398125 (-) 1365 WP_017419273.1 aspartate kinase -
  CK238_RS02035 (CK238_02025) ceuB 398539..399492 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  CK238_RS02040 (CK238_02030) - 399482..400429 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  CK238_RS02045 (CK238_02035) - 400423..401181 (+) 759 WP_063636991.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=244743 CK238_RS02015 WP_003156334.1 396302..396421(+) (phrC) [Bacillus velezensis strain K26]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=244743 CK238_RS02015 WP_003156334.1 396302..396421(+) (phrC) [Bacillus velezensis strain K26]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment