Detailed information
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | CJZ70_RS07325 | Genome accession | NZ_CP022890 |
| Coordinates | 1428380..1428790 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain DKU_NT_02 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1404861..1443631 | 1428380..1428790 | within | 0 |
Gene organization within MGE regions
Location: 1404861..1443631
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CJZ70_RS07205 (CJZ70_07205) | czcR | 1404861..1405727 (-) | 867 | WP_014480355.1 | LysR family transcriptional regulator CzcR | - |
| CJZ70_RS07210 (CJZ70_07210) | yrdR | 1405853..1406818 (+) | 966 | WP_014480354.1 | DMT family transporter | - |
| CJZ70_RS07215 (CJZ70_07215) | yrzO | 1406836..1406979 (+) | 144 | WP_014477437.1 | YrzO family protein | - |
| CJZ70_RS07220 (CJZ70_07220) | yrkA | 1407269..1408573 (+) | 1305 | WP_019712547.1 | hemolysin family protein | - |
| CJZ70_RS07225 (CJZ70_07225) | - | 1408819..1410066 (+) | 1248 | WP_031600262.1 | IS256-like element ISBsu2 family transposase | - |
| CJZ70_RS07230 (CJZ70_07230) | - | 1410501..1410791 (-) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| CJZ70_RS07235 (CJZ70_07235) | istA | 1410951..1412498 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| CJZ70_RS07240 (CJZ70_07240) | istB | 1412495..1413253 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| CJZ70_RS07245 (CJZ70_07245) | atxG | 1413387..1413963 (-) | 577 | Protein_1425 | suppressor of fused domain protein | - |
| CJZ70_RS07250 (CJZ70_07250) | - | 1414231..1414464 (-) | 234 | WP_224588641.1 | hypothetical protein | - |
| CJZ70_RS21155 | - | 1414553..1414756 (+) | 204 | WP_123772462.1 | hypothetical protein | - |
| CJZ70_RS07255 (CJZ70_07255) | - | 1415064..1415576 (-) | 513 | WP_014477426.1 | hypothetical protein | - |
| CJZ70_RS07260 (CJZ70_07260) | cdiI | 1415648..1416007 (-) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| CJZ70_RS07265 (CJZ70_07265) | - | 1416104..1416556 (-) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| CJZ70_RS07270 (CJZ70_07270) | - | 1416655..1417095 (-) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| CJZ70_RS07275 (CJZ70_07275) | - | 1417498..1417785 (-) | 288 | WP_014480331.1 | hypothetical protein | - |
| CJZ70_RS21735 (CJZ70_07280) | - | 1417799..1419725 (-) | 1927 | Protein_1433 | T7SS effector LXG polymorphic toxin | - |
| CJZ70_RS07285 (CJZ70_07285) | - | 1419907..1421034 (+) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| CJZ70_RS07295 (CJZ70_07295) | - | 1421773..1422168 (-) | 396 | WP_046160622.1 | VOC family protein | - |
| CJZ70_RS07300 (CJZ70_07300) | - | 1423109..1423999 (-) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| CJZ70_RS07305 (CJZ70_07305) | fumC | 1424166..1425554 (+) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| CJZ70_RS07310 (CJZ70_07310) | - | 1425773..1425912 (+) | 140 | Protein_1438 | recombinase family protein | - |
| CJZ70_RS07315 (CJZ70_07315) | - | 1426035..1427282 (+) | 1248 | WP_031600262.1 | IS256-like element ISBsu2 family transposase | - |
| CJZ70_RS21160 | - | 1427359..1427457 (-) | 99 | WP_031600702.1 | hypothetical protein | - |
| CJZ70_RS07320 (CJZ70_07320) | sigK | 1427457..1428185 (-) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| CJZ70_RS07325 (CJZ70_07325) | nucA/comI | 1428380..1428790 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| CJZ70_RS07330 (CJZ70_07330) | yqeB | 1428823..1429545 (-) | 723 | WP_014480321.1 | hypothetical protein | - |
| CJZ70_RS07335 (CJZ70_07335) | gnd | 1429796..1430689 (+) | 894 | WP_069837643.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| CJZ70_RS07340 (CJZ70_07340) | yqeD | 1430708..1431334 (-) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| CJZ70_RS07345 (CJZ70_07345) | cwlH | 1431521..1432273 (+) | 753 | WP_069837642.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| CJZ70_RS07350 (CJZ70_07350) | yqeF | 1432525..1433256 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| CJZ70_RS07355 (CJZ70_07355) | - | 1433562..1433702 (-) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| CJZ70_RS07360 (CJZ70_07360) | yqeG | 1434064..1434581 (+) | 518 | Protein_1449 | YqeG family HAD IIIA-type phosphatase | - |
| CJZ70_RS07365 (CJZ70_07365) | yqeH | 1434585..1435684 (+) | 1100 | Protein_1450 | ribosome biogenesis GTPase YqeH | - |
| CJZ70_RS07370 (CJZ70_07370) | aroE | 1435702..1436544 (+) | 843 | WP_014480317.1 | shikimate dehydrogenase | - |
| CJZ70_RS07375 (CJZ70_07375) | yhbY | 1436538..1436828 (+) | 291 | WP_003226133.1 | ribosome assembly RNA-binding protein YhbY | - |
| CJZ70_RS07380 (CJZ70_07380) | nadD | 1436840..1437409 (+) | 570 | WP_004398676.1 | nicotinate-nucleotide adenylyltransferase | - |
| CJZ70_RS07385 (CJZ70_07385) | yqeK | 1437399..1437959 (+) | 561 | WP_014480316.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| CJZ70_RS07390 (CJZ70_07390) | rsfS | 1437977..1438333 (+) | 357 | WP_014480315.1 | ribosome silencing factor | - |
| CJZ70_RS07395 (CJZ70_07395) | yqeM | 1438330..1439073 (+) | 744 | WP_046160609.1 | class I SAM-dependent methyltransferase | - |
| CJZ70_RS07400 (CJZ70_07400) | comER | 1439139..1439960 (-) | 822 | WP_032726195.1 | late competence protein ComER | - |
| CJZ70_RS07405 (CJZ70_07405) | comEA | 1440044..1440661 (+) | 618 | WP_046160608.1 | competence protein ComEA | Machinery gene |
| CJZ70_RS07410 (CJZ70_07410) | comEB | 1440728..1441297 (+) | 570 | WP_003229978.1 | ComE operon protein 2 | - |
| CJZ70_RS07415 (CJZ70_07415) | comEC | 1441301..1443631 (+) | 2331 | WP_046160607.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=242542 CJZ70_RS07325 WP_009967785.1 1428380..1428790(+) (nucA/comI) [Bacillus subtilis strain DKU_NT_02]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=242542 CJZ70_RS07325 WP_009967785.1 1428380..1428790(+) (nucA/comI) [Bacillus subtilis strain DKU_NT_02]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |