Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CHN56_RS19120 | Genome accession | NZ_CP022654 |
| Coordinates | 3737445..3737618 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SCDB 291 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3732445..3742618
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CHN56_RS19070 (CHN56_03776) | comGD | 3732566..3733003 (+) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| CHN56_RS19075 (CHN56_03777) | comGE | 3732987..3733301 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CHN56_RS19080 (CHN56_03778) | comGF | 3733315..3733710 (+) | 396 | WP_094247733.1 | competence type IV pilus minor pilin ComGF | - |
| CHN56_RS19085 (CHN56_03779) | comGG | 3733711..3734088 (+) | 378 | WP_094247734.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CHN56_RS19090 (CHN56_03780) | - | 3734145..3734324 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| CHN56_RS19095 (CHN56_03781) | - | 3734364..3734693 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| CHN56_RS19100 (CHN56_03782) | tapA | 3734952..3735623 (+) | 672 | WP_070082109.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CHN56_RS19105 (CHN56_03783) | sipW | 3735595..3736179 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| CHN56_RS19110 (CHN56_03784) | tasA | 3736243..3737028 (+) | 786 | WP_094247735.1 | biofilm matrix protein TasA | - |
| CHN56_RS19115 (CHN56_03785) | sinR | 3737076..3737411 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CHN56_RS19120 (CHN56_03786) | sinI | 3737445..3737618 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CHN56_RS19125 (CHN56_03787) | - | 3737795..3738589 (-) | 795 | WP_014305407.1 | YqhG family protein | - |
| CHN56_RS19130 (CHN56_03788) | - | 3738607..3740277 (-) | 1671 | WP_069013074.1 | SNF2-related protein | - |
| CHN56_RS19135 (CHN56_03789) | gcvT | 3740701..3741801 (+) | 1101 | WP_094247736.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=241350 CHN56_RS19120 WP_003153105.1 3737445..3737618(-) (sinI) [Bacillus velezensis strain SCDB 291]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=241350 CHN56_RS19120 WP_003153105.1 3737445..3737618(-) (sinI) [Bacillus velezensis strain SCDB 291]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |