Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   CHN56_RS19075 Genome accession   NZ_CP022654
Coordinates   3732987..3733301 (+) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain SCDB 291     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3727987..3738301
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CHN56_RS19050 (CHN56_03772) - 3729027..3729977 (+) 951 WP_071391609.1 magnesium transporter CorA family protein -
  CHN56_RS19055 (CHN56_03773) comGA 3730169..3731239 (+) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  CHN56_RS19060 (CHN56_03774) comGB 3731226..3732263 (+) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  CHN56_RS19065 (CHN56_03775) comGC 3732268..3732576 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CHN56_RS19070 (CHN56_03776) comGD 3732566..3733003 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  CHN56_RS19075 (CHN56_03777) comGE 3732987..3733301 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  CHN56_RS19080 (CHN56_03778) comGF 3733315..3733710 (+) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  CHN56_RS19085 (CHN56_03779) comGG 3733711..3734088 (+) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  CHN56_RS19090 (CHN56_03780) - 3734145..3734324 (+) 180 WP_003153093.1 YqzE family protein -
  CHN56_RS19095 (CHN56_03781) - 3734364..3734693 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CHN56_RS19100 (CHN56_03782) tapA 3734952..3735623 (+) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  CHN56_RS19105 (CHN56_03783) sipW 3735595..3736179 (+) 585 WP_012117977.1 signal peptidase I SipW -
  CHN56_RS19110 (CHN56_03784) tasA 3736243..3737028 (+) 786 WP_094247735.1 biofilm matrix protein TasA -
  CHN56_RS19115 (CHN56_03785) sinR 3737076..3737411 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CHN56_RS19120 (CHN56_03786) sinI 3737445..3737618 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=241347 CHN56_RS19075 WP_015388003.1 3732987..3733301(+) (comGE) [Bacillus velezensis strain SCDB 291]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=241347 CHN56_RS19075 WP_015388003.1 3732987..3733301(+) (comGE) [Bacillus velezensis strain SCDB 291]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment