Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   CHN56_RS08925 Genome accession   NZ_CP022654
Coordinates   1806117..1806236 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SCDB 291     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1801117..1811236
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CHN56_RS08900 (CHN56_01766) - 1801356..1802114 (-) 759 WP_022552588.1 ABC transporter ATP-binding protein -
  CHN56_RS08905 (CHN56_01767) - 1802108..1803055 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  CHN56_RS08910 (CHN56_01768) ceuB 1803045..1803998 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  CHN56_RS08915 (CHN56_01769) - 1804413..1805777 (+) 1365 WP_070081361.1 aspartate kinase -
  CHN56_RS08920 - 1805872..1805967 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  CHN56_RS08925 (CHN56_01770) phrC 1806117..1806236 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CHN56_RS08930 (CHN56_01771) rapC 1806220..1807368 (-) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  CHN56_RS08935 (CHN56_01772) - 1807521..1808954 (-) 1434 WP_161941456.1 HAMP domain-containing sensor histidine kinase -
  CHN56_RS08940 (CHN56_01773) - 1808941..1809624 (-) 684 WP_094247243.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=241305 CHN56_RS08925 WP_003156334.1 1806117..1806236(-) (phrC) [Bacillus velezensis strain SCDB 291]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=241305 CHN56_RS08925 WP_003156334.1 1806117..1806236(-) (phrC) [Bacillus velezensis strain SCDB 291]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment