Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C7M30_RS19165 Genome accession   NZ_CP028218
Coordinates   3708778..3709161 (+) Length   127 a.a.
NCBI ID   WP_076458111.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102756     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3703778..3714161
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M30_RS19130 (C7M30_03795) corA 3704233..3705186 (+) 954 WP_015483432.1 magnesium transporter CorA -
  C7M30_RS19135 (C7M30_03796) - 3705188..3705385 (+) 198 WP_160244870.1 CBS domain-containing protein -
  C7M30_RS19140 (C7M30_03797) comGA 3705596..3706666 (+) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  C7M30_RS19145 (C7M30_03798) comGB 3706653..3707690 (+) 1038 WP_160244871.1 comG operon protein ComGB Machinery gene
  C7M30_RS19150 (C7M30_03799) comGC 3707704..3708000 (+) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  C7M30_RS19155 (C7M30_03800) comGD 3707990..3708421 (+) 432 WP_160244872.1 comG operon protein ComGD Machinery gene
  C7M30_RS19160 (C7M30_03801) comGE 3708405..3708752 (+) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  C7M30_RS19165 comGF 3708778..3709161 (+) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  C7M30_RS19170 (C7M30_03803) comGG 3709162..3709536 (+) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  C7M30_RS19175 (C7M30_03804) spoIITA 3709608..3709787 (+) 180 WP_014480252.1 YqzE family protein -
  C7M30_RS19180 (C7M30_03805) yqzG 3709829..3710155 (-) 327 WP_160244873.1 YqzG/YhdC family protein -
  C7M30_RS19185 (C7M30_03806) tapA 3710427..3711188 (+) 762 WP_160244874.1 amyloid fiber anchoring/assembly protein TapA -
  C7M30_RS19190 (C7M30_03807) sipW 3711172..3711744 (+) 573 WP_160245036.1 signal peptidase I SipW -
  C7M30_RS19195 (C7M30_03808) tasA 3711808..3712593 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  C7M30_RS19200 (C7M30_03809) sinR 3712685..3713020 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M30_RS19205 (C7M30_03810) sinI 3713054..3713227 (-) 174 WP_014477323.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14448.54 Da        Isoelectric Point: 6.2135

>NTDB_id=240580 C7M30_RS19165 WP_076458111.1 3708778..3709161(+) (comGF) [Bacillus subtilis strain SRCM102756]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=240580 C7M30_RS19165 WP_076458111.1 3708778..3709161(+) (comGF) [Bacillus subtilis strain SRCM102756]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.413

99.213

0.976


Multiple sequence alignment