Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C7M26_RS19445 Genome accession   NZ_CP028212
Coordinates   3717655..3717795 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM102748     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3712655..3722795
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M26_RS19415 (C7M26_03825) yueI 3712950..3713348 (+) 399 WP_015251331.1 YueI family protein -
  C7M26_RS19420 (C7M26_03826) pncA 3713445..3713996 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C7M26_RS19425 (C7M26_03827) pncB 3714012..3715484 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C7M26_RS19430 (C7M26_03828) pdeH 3715621..3716850 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C7M26_RS19435 (C7M26_03829) - 3716826..3717194 (-) 369 WP_014477834.1 hypothetical protein -
  C7M26_RS19440 - 3717308..3717433 (-) 126 WP_003228793.1 hypothetical protein -
  C7M26_RS19445 (C7M26_03830) degQ 3717655..3717795 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C7M26_RS19450 (C7M26_03831) comQ 3717980..3718843 (+) 864 WP_032722437.1 polyprenyl synthetase family protein Regulator
  C7M26_RS19455 (C7M26_03832) comX 3718845..3719066 (+) 222 WP_014480704.1 competence pheromone ComX -
  C7M26_RS19460 (C7M26_03833) comP 3719082..3721394 (+) 2313 WP_032722435.1 histidine kinase Regulator
  C7M26_RS19465 (C7M26_03834) comA 3721475..3722119 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C7M26_RS19470 (C7M26_03835) yuxO 3722138..3722518 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=239966 C7M26_RS19445 WP_003220708.1 3717655..3717795(+) (degQ) [Bacillus subtilis strain SRCM102748]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=239966 C7M26_RS19445 WP_003220708.1 3717655..3717795(+) (degQ) [Bacillus subtilis strain SRCM102748]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1