Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   CGZ47_RS06805 Genome accession   NZ_CP022475
Coordinates   1312922..1313230 (-) Length   102 a.a.
NCBI ID   WP_004270901.1    Uniprot ID   A0AAJ0LFY3
Organism   Latilactobacillus curvatus strain KG6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1307922..1318230
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CGZ47_RS06770 (CGZ47_06770) - 1308394..1308906 (-) 513 Protein_1310 IS30-like element ISLpl1 family transposase -
  CGZ47_RS06780 (CGZ47_06780) - 1309104..1310297 (-) 1194 WP_004270911.1 acetate/propionate family kinase -
  CGZ47_RS06785 (CGZ47_06785) - 1310319..1311329 (-) 1011 WP_054644024.1 class I SAM-dependent methyltransferase -
  CGZ47_RS06790 (CGZ47_06790) - 1311454..1311777 (-) 324 WP_039099486.1 hypothetical protein -
  CGZ47_RS06795 (CGZ47_06795) - 1311755..1312135 (-) 381 WP_004270914.1 ComGF family competence protein -
  CGZ47_RS10900 - 1312157..1312240 (-) 84 Protein_1315 type II secretion system protein -
  CGZ47_RS10555 - 1312206..1312433 (-) 228 WP_158070299.1 hypothetical protein -
  CGZ47_RS06800 (CGZ47_06800) - 1312498..1312890 (-) 393 WP_004270899.1 hypothetical protein -
  CGZ47_RS06805 (CGZ47_06805) comGC 1312922..1313230 (-) 309 WP_004270901.1 competence type IV pilus major pilin ComGC Machinery gene
  CGZ47_RS06810 (CGZ47_06810) comGB 1313227..1314228 (-) 1002 WP_076786758.1 type II secretion system F family protein Machinery gene
  CGZ47_RS06815 (CGZ47_06815) comGA 1314218..1315093 (-) 876 WP_076786756.1 competence type IV pilus ATPase ComGA Machinery gene
  CGZ47_RS06820 (CGZ47_06820) - 1315197..1315928 (-) 732 WP_089542239.1 YebC/PmpR family DNA-binding transcriptional regulator -
  CGZ47_RS06825 (CGZ47_06825) - 1316018..1316518 (-) 501 WP_004270893.1 VanZ family protein -
  CGZ47_RS06830 (CGZ47_06830) - 1316621..1316998 (+) 378 WP_039099519.1 hypothetical protein -
  CGZ47_RS06840 (CGZ47_06840) - 1317179..1317514 (-) 336 WP_076786752.1 hypothetical protein -
  CGZ47_RS06845 (CGZ47_06845) - 1317709..1317948 (+) 240 WP_004270892.1 cytochrome b5 domain-containing protein -

Sequence


Protein


Download         Length: 102 a.a.        Molecular weight: 11238.13 Da        Isoelectric Point: 9.6264

>NTDB_id=239837 CGZ47_RS06805 WP_004270901.1 1312922..1313230(-) (comGC) [Latilactobacillus curvatus strain KG6]
MKKKRNAFTLIEMVVVLAVIAMLVLLIAPNLMHQKETAEQKTDTALVATIQTQVELAEDDGKTVSSLADLASGEKYLTNN
QVKQAEKRGITIKDNKVVQNTK

Nucleotide


Download         Length: 309 bp        

>NTDB_id=239837 CGZ47_RS06805 WP_004270901.1 1312922..1313230(-) (comGC) [Latilactobacillus curvatus strain KG6]
ATGAAGAAGAAAAGAAATGCATTTACATTGATCGAAATGGTCGTTGTGCTAGCTGTGATAGCAATGTTAGTCTTGTTAAT
TGCACCTAATTTAATGCATCAGAAAGAGACAGCTGAGCAAAAAACGGATACGGCTCTAGTGGCAACGATTCAAACACAAG
TTGAATTAGCTGAGGATGACGGTAAAACGGTGTCGAGTCTAGCCGATTTAGCATCAGGTGAAAAATATTTAACCAATAAT
CAGGTTAAACAAGCTGAAAAACGCGGCATAACAATTAAGGATAATAAAGTTGTTCAAAATACAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

60

98.039

0.588


Multiple sequence alignment