Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C7M16_RS14575 Genome accession   NZ_CP028201
Coordinates   2882349..2882489 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM102753     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2877349..2887489
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M16_RS14550 (C7M16_02871) yuxO 2877691..2878071 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  C7M16_RS14555 (C7M16_02872) comA 2878090..2878734 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C7M16_RS14560 (C7M16_02873) comP 2878815..2881115 (-) 2301 WP_088300729.1 histidine kinase Regulator
  C7M16_RS14565 (C7M16_02874) comX 2881127..2881291 (-) 165 WP_015384519.1 competence pheromone ComX -
  C7M16_RS14570 (C7M16_02875) comQ 2881304..2882164 (-) 861 WP_128422373.1 polyprenyl synthetase family protein Regulator
  C7M16_RS14575 (C7M16_02876) degQ 2882349..2882489 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C7M16_RS14580 - 2882711..2882836 (+) 126 WP_144500545.1 hypothetical protein -
  C7M16_RS14585 (C7M16_02877) - 2882950..2883318 (+) 369 WP_144500544.1 hypothetical protein -
  C7M16_RS14590 (C7M16_02878) pdeH 2883294..2884523 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C7M16_RS14595 (C7M16_02879) pncB 2884660..2886132 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C7M16_RS14600 (C7M16_02880) pncA 2886148..2886699 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  C7M16_RS14605 (C7M16_02881) yueI 2886796..2887194 (-) 399 WP_085185940.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=239492 C7M16_RS14575 WP_003220708.1 2882349..2882489(-) (degQ) [Bacillus subtilis strain SRCM102753]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=239492 C7M16_RS14575 WP_003220708.1 2882349..2882489(-) (degQ) [Bacillus subtilis strain SRCM102753]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterProScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1