Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CFN77_RS15160 Genome accession   NZ_CP022319
Coordinates   2923053..2923193 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain SGAir0031     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2918053..2928193
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFN77_RS15135 (CFN77_15285) - 2918375..2918764 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  CFN77_RS15140 (CFN77_15290) comA 2918788..2919429 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  CFN77_RS15145 (CFN77_15295) comP 2919510..2921816 (-) 2307 WP_073412603.1 ATP-binding protein Regulator
  CFN77_RS15150 (CFN77_15300) comX 2921830..2922000 (-) 171 WP_017358941.1 competence pheromone ComX -
  CFN77_RS15155 (CFN77_15305) - 2921978..2922901 (-) 924 WP_096881800.1 polyprenyl synthetase family protein -
  CFN77_RS15160 (CFN77_15310) degQ 2923053..2923193 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  CFN77_RS15165 (CFN77_15315) - 2923699..2924052 (+) 354 WP_017367963.1 hypothetical protein -
  CFN77_RS15170 (CFN77_15320) - 2924089..2925315 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  CFN77_RS15175 (CFN77_15325) - 2925456..2926925 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  CFN77_RS15180 (CFN77_15330) - 2926943..2927494 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  CFN77_RS15185 (CFN77_15335) - 2927555..2927962 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=238331 CFN77_RS15160 WP_003213123.1 2923053..2923193(-) (degQ) [Bacillus altitudinis strain SGAir0031]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=238331 CFN77_RS15160 WP_003213123.1 2923053..2923193(-) (degQ) [Bacillus altitudinis strain SGAir0031]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment