Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSSX_RS12145 Genome accession   NZ_CP022287
Coordinates   2377206..2377589 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis strain SX01705     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2372206..2382589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSSX_RS12105 (BSSX_2499) sinI 2373141..2373314 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSSX_RS12110 (BSSX_2500) sinR 2373348..2373683 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSSX_RS12115 (BSSX_2501) tasA 2373776..2374561 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  BSSX_RS12120 (BSSX_2502) sipW 2374625..2375197 (-) 573 WP_080030740.1 signal peptidase I SipW -
  BSSX_RS12125 (BSSX_2503) tapA 2375181..2375942 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  BSSX_RS12130 (BSSX_2504) yqzG 2376212..2376538 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  BSSX_RS12135 (BSSX_2505) spoIITA 2376580..2376759 (-) 180 WP_003230176.1 YqzE family protein -
  BSSX_RS12140 (BSSX_2506) comGG 2376831..2377205 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSSX_RS12145 (BSSX_2507) comGF 2377206..2377589 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  BSSX_RS12150 (BSSX_2508) comGE 2377615..2377962 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  BSSX_RS12155 (BSSX_2509) comGD 2377946..2378377 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  BSSX_RS12160 (BSSX_2510) comGC 2378367..2378663 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  BSSX_RS12165 (BSSX_2511) comGB 2378677..2379714 (-) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  BSSX_RS12170 (BSSX_2512) comGA 2379701..2380771 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  BSSX_RS12180 (BSSX_2514) corA 2381181..2382134 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=237996 BSSX_RS12145 WP_015384087.1 2377206..2377589(-) (comGF) [Bacillus subtilis strain SX01705]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=237996 BSSX_RS12145 WP_015384087.1 2377206..2377589(-) (comGF) [Bacillus subtilis strain SX01705]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment