Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSSX_RS12105 Genome accession   NZ_CP022287
Coordinates   2373141..2373314 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SX01705     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2368141..2378314
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSSX_RS12090 (BSSX_2496) gcvT 2368940..2370028 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  BSSX_RS12095 (BSSX_2497) hepAA 2370470..2372143 (+) 1674 WP_015384082.1 SNF2-related protein -
  BSSX_RS12100 (BSSX_2498) yqhG 2372164..2372958 (+) 795 WP_003230200.1 YqhG family protein -
  BSSX_RS12105 (BSSX_2499) sinI 2373141..2373314 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSSX_RS12110 (BSSX_2500) sinR 2373348..2373683 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSSX_RS12115 (BSSX_2501) tasA 2373776..2374561 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  BSSX_RS12120 (BSSX_2502) sipW 2374625..2375197 (-) 573 WP_080030740.1 signal peptidase I SipW -
  BSSX_RS12125 (BSSX_2503) tapA 2375181..2375942 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  BSSX_RS12130 (BSSX_2504) yqzG 2376212..2376538 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  BSSX_RS12135 (BSSX_2505) spoIITA 2376580..2376759 (-) 180 WP_003230176.1 YqzE family protein -
  BSSX_RS12140 (BSSX_2506) comGG 2376831..2377205 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSSX_RS12145 (BSSX_2507) comGF 2377206..2377589 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  BSSX_RS12150 (BSSX_2508) comGE 2377615..2377962 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=237993 BSSX_RS12105 WP_003230187.1 2373141..2373314(+) (sinI) [Bacillus subtilis strain SX01705]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=237993 BSSX_RS12105 WP_003230187.1 2373141..2373314(+) (sinI) [Bacillus subtilis strain SX01705]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment