Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   CEQ16_RS12215 Genome accession   NZ_CP022059
Coordinates   2348110..2348637 (-) Length   175 a.a.
NCBI ID   WP_033598033.1    Uniprot ID   -
Organism   Enterococcus faecalis strain FDAARGOS_338     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2315474..2360325 2348110..2348637 within 0


Gene organization within MGE regions


Location: 2315474..2360325
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CEQ16_RS11995 (CEQ16_11980) - 2315474..2315917 (+) 444 WP_002356885.1 flavodoxin -
  CEQ16_RS12000 (CEQ16_11985) - 2315992..2316465 (-) 474 WP_002356884.1 TspO/MBR family protein -
  CEQ16_RS12005 (CEQ16_11990) - 2316623..2317195 (-) 573 WP_002356883.1 TetR/AcrR family transcriptional regulator -
  CEQ16_RS12010 (CEQ16_11995) - 2317446..2318684 (+) 1239 WP_002362125.1 aminopeptidase -
  CEQ16_RS12015 (CEQ16_12000) - 2318944..2319324 (+) 381 WP_002381671.1 PH domain-containing protein -
  CEQ16_RS12025 (CEQ16_12010) - 2319695..2320276 (+) 582 WP_085370454.1 DUF4950 domain-containing protein -
  CEQ16_RS12030 (CEQ16_12015) - 2320633..2322135 (+) 1503 WP_105577450.1 glucosyltransferase domain-containing protein -
  CEQ16_RS12035 (CEQ16_12020) - 2322199..2323464 (-) 1266 WP_002388981.1 peptidoglycan DD-metalloendopeptidase family protein -
  CEQ16_RS12040 (CEQ16_12025) - 2323553..2323933 (-) 381 WP_002369082.1 hypothetical protein -
  CEQ16_RS12045 (CEQ16_12030) - 2323946..2325205 (-) 1260 WP_073437768.1 LysM peptidoglycan-binding domain-containing protein -
  CEQ16_RS12050 (CEQ16_12035) - 2325211..2325414 (-) 204 WP_002381666.1 phage holin -
  CEQ16_RS12055 (CEQ16_12040) - 2325411..2325638 (-) 228 WP_002381665.1 hypothetical protein -
  CEQ16_RS12060 (CEQ16_12045) - 2325712..2327475 (-) 1764 WP_105577452.1 hypothetical protein -
  CEQ16_RS14765 - 2327486..2327659 (-) 174 WP_002369077.1 hypothetical protein -
  CEQ16_RS12065 (CEQ16_12050) - 2327660..2329675 (-) 2016 WP_002389090.1 phage tail protein -
  CEQ16_RS12070 (CEQ16_12055) - 2329692..2330621 (-) 930 WP_105577453.1 distal tail protein Dit -
  CEQ16_RS12075 (CEQ16_12060) - 2330622..2334029 (-) 3408 WP_105577454.1 tape measure protein -
  CEQ16_RS12080 (CEQ16_12065) - 2334045..2334302 (-) 258 WP_002381661.1 hypothetical protein -
  CEQ16_RS12085 (CEQ16_12070) - 2334395..2334745 (-) 351 WP_002389853.1 tail assembly chaperone -
  CEQ16_RS12090 (CEQ16_12075) - 2334801..2335259 (-) 459 WP_048949752.1 hypothetical protein -
  CEQ16_RS12095 (CEQ16_12080) - 2335337..2335867 (-) 531 WP_002373072.1 phage major tail protein, TP901-1 family -
  CEQ16_RS12100 (CEQ16_12085) - 2335883..2336272 (-) 390 WP_002369068.1 hypothetical protein -
  CEQ16_RS12105 (CEQ16_12090) - 2336269..2336649 (-) 381 WP_002373070.1 HK97-gp10 family putative phage morphogenesis protein -
  CEQ16_RS12110 (CEQ16_12095) - 2336624..2336959 (-) 336 WP_002381656.1 hypothetical protein -
  CEQ16_RS12115 (CEQ16_12100) - 2336956..2337288 (-) 333 WP_002373068.1 phage head-tail connector protein -
  CEQ16_RS12120 (CEQ16_12105) - 2337362..2338294 (-) 933 WP_002381655.1 phage major capsid protein -
  CEQ16_RS12125 (CEQ16_12110) - 2338307..2338906 (-) 600 WP_002373065.1 DUF4355 domain-containing protein -
  CEQ16_RS12130 (CEQ16_12115) - 2339101..2339322 (-) 222 WP_002381654.1 hypothetical protein -
  CEQ16_RS12135 (CEQ16_12120) - 2339319..2339588 (-) 270 WP_002381653.1 hypothetical protein -
  CEQ16_RS12140 (CEQ16_12125) - 2339589..2340527 (-) 939 WP_002381652.1 minor capsid protein -
  CEQ16_RS12145 (CEQ16_12130) - 2340532..2342070 (-) 1539 WP_002381651.1 phage portal protein -
  CEQ16_RS12150 (CEQ16_12135) - 2342084..2343478 (-) 1395 WP_002398577.1 terminase large subunit domain-containing protein -
  CEQ16_RS12155 (CEQ16_12140) - 2343465..2343938 (-) 474 WP_002398576.1 terminase small subunit -
  CEQ16_RS12160 (CEQ16_12145) - 2344007..2344651 (-) 645 WP_105577455.1 hypothetical protein -
  CEQ16_RS12165 (CEQ16_12150) - 2344902..2345321 (-) 420 WP_002395898.1 transcriptional regulator -
  CEQ16_RS12170 (CEQ16_12155) - 2345322..2345534 (-) 213 WP_105577456.1 hypothetical protein -
  CEQ16_RS12175 (CEQ16_12160) - 2345528..2345845 (-) 318 WP_105577457.1 replicase -
  CEQ16_RS12180 (CEQ16_12165) - 2345846..2346349 (-) 504 WP_105577458.1 DUF1642 domain-containing protein -
  CEQ16_RS12185 (CEQ16_12170) - 2346346..2346612 (-) 267 WP_105577459.1 hypothetical protein -
  CEQ16_RS12190 (CEQ16_12175) - 2346609..2346803 (-) 195 WP_105577460.1 hypothetical protein -
  CEQ16_RS14770 - 2346800..2346961 (-) 162 WP_192575138.1 hypothetical protein -
  CEQ16_RS12195 (CEQ16_12180) - 2346958..2347356 (-) 399 WP_105577461.1 YopX family protein -
  CEQ16_RS12200 (CEQ16_12185) - 2347340..2347519 (-) 180 WP_105577462.1 hypothetical protein -
  CEQ16_RS12205 (CEQ16_12190) - 2347542..2347748 (-) 207 WP_002359516.1 hypothetical protein -
  CEQ16_RS12210 (CEQ16_12195) - 2347768..2348097 (-) 330 WP_105577463.1 hypothetical protein -
  CEQ16_RS12215 (CEQ16_12200) ssb 2348110..2348637 (-) 528 WP_033598033.1 single-stranded DNA-binding protein Machinery gene
  CEQ16_RS12220 (CEQ16_12205) - 2348627..2348935 (-) 309 WP_002381633.1 MazG-like family protein -
  CEQ16_RS12225 (CEQ16_12210) - 2348935..2349741 (-) 807 WP_105577464.1 helix-turn-helix domain-containing protein -
  CEQ16_RS12230 (CEQ16_12215) - 2349745..2350386 (-) 642 WP_083578492.1 putative HNHc nuclease -
  CEQ16_RS12235 (CEQ16_12220) - 2350383..2351321 (-) 939 WP_105577465.1 DUF1351 domain-containing protein -
  CEQ16_RS12240 (CEQ16_12225) - 2351321..2352064 (-) 744 WP_105577466.1 ERF family protein -
  CEQ16_RS12245 (CEQ16_12230) - 2352150..2352452 (-) 303 WP_010828389.1 hypothetical protein -
  CEQ16_RS12250 (CEQ16_12240) - 2352618..2352803 (+) 186 WP_025188165.1 DUF1508 domain-containing protein -
  CEQ16_RS12255 (CEQ16_12245) - 2353205..2353663 (+) 459 WP_105577467.1 hypothetical protein -
  CEQ16_RS12260 (CEQ16_12250) - 2353726..2353926 (-) 201 WP_105577468.1 hypothetical protein -
  CEQ16_RS12265 (CEQ16_12255) - 2353946..2354371 (-) 426 Protein_2258 Rha family transcriptional regulator -
  CEQ16_RS12270 (CEQ16_12260) - 2354450..2354974 (+) 525 WP_105577469.1 hypothetical protein -
  CEQ16_RS12275 (CEQ16_12265) - 2355086..2355334 (-) 249 WP_105577470.1 hypothetical protein -
  CEQ16_RS12280 (CEQ16_12270) - 2355350..2356069 (-) 720 WP_002389123.1 phage antirepressor KilAC domain-containing protein -
  CEQ16_RS12285 (CEQ16_12275) - 2356151..2356384 (-) 234 WP_002389146.1 DUF739 family protein -
  CEQ16_RS12290 (CEQ16_12280) - 2356543..2357115 (+) 573 WP_002389244.1 helix-turn-helix domain-containing protein -
  CEQ16_RS12295 (CEQ16_12285) - 2357090..2357605 (+) 516 WP_002406281.1 ImmA/IrrE family metallo-endopeptidase -
  CEQ16_RS12300 (CEQ16_12290) - 2357693..2358247 (+) 555 WP_105577471.1 hypothetical protein -
  CEQ16_RS12305 (CEQ16_12295) - 2358289..2358489 (+) 201 WP_002389192.1 hypothetical protein -
  CEQ16_RS12310 (CEQ16_12300) - 2358550..2359122 (+) 573 WP_104832832.1 hypothetical protein -
  CEQ16_RS12315 (CEQ16_12305) - 2359189..2360325 (+) 1137 WP_105577472.1 site-specific integrase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19361.20 Da        Isoelectric Point: 4.7078

>NTDB_id=236323 CEQ16_RS12215 WP_033598033.1 2348110..2348637(-) (ssb) [Enterococcus faecalis strain FDAARGOS_338]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSIQTSQNSGTSVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=236323 CEQ16_RS12215 WP_033598033.1 2348110..2348637(-) (ssb) [Enterococcus faecalis strain FDAARGOS_338]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAATTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGTCAAAAAG
CACCAACGAGAATAGAAATAGCATTCAGACTTCACAGAATAGCGGTACAAGCGTTCAAAACAATTTCGAGAGTAATTATG
CCACAAATCAAAATAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTTGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.659

100

0.6
  ssbA Bacillus subtilis subsp. subtilis str. 168

56

100

0.56

Multiple sequence alignment