Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CEG11_RS14850 Genome accession   NZ_CP021976
Coordinates   2987690..2987830 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain T20E-257     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2982690..2992830
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CEG11_RS14825 (CEG11_14825) - 2982987..2983370 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  CEG11_RS14830 (CEG11_14830) comA 2983392..2984036 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  CEG11_RS14835 (CEG11_14835) comP 2984117..2986420 (-) 2304 WP_003152050.1 histidine kinase Regulator
  CEG11_RS14845 (CEG11_14845) comQ 2986573..2987505 (-) 933 WP_050560672.1 class 1 isoprenoid biosynthesis enzyme Regulator
  CEG11_RS14850 (CEG11_14850) degQ 2987690..2987830 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CEG11_RS14855 (CEG11_14855) - 2988296..2988637 (+) 342 WP_003152040.1 hypothetical protein -
  CEG11_RS14860 (CEG11_14860) - 2988644..2989864 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  CEG11_RS14865 (CEG11_14865) - 2989994..2991460 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  CEG11_RS14870 (CEG11_14870) - 2991478..2992029 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  CEG11_RS14875 (CEG11_14875) - 2992126..2992524 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=235523 CEG11_RS14850 WP_003152043.1 2987690..2987830(-) (degQ) [Bacillus velezensis strain T20E-257]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=235523 CEG11_RS14850 WP_003152043.1 2987690..2987830(-) (degQ) [Bacillus velezensis strain T20E-257]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment