Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   CEG11_RS11930 Genome accession   NZ_CP021976
Coordinates   2442323..2442760 (-) Length   145 a.a.
NCBI ID   WP_003153088.1    Uniprot ID   -
Organism   Bacillus velezensis strain T20E-257     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2437323..2447760
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CEG11_RS11880 (CEG11_11880) sinI 2437708..2437881 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CEG11_RS11885 (CEG11_11885) sinR 2437915..2438250 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CEG11_RS11890 (CEG11_11890) tasA 2438298..2439083 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  CEG11_RS11895 (CEG11_11895) sipW 2439147..2439731 (-) 585 WP_003153100.1 signal peptidase I SipW -
  CEG11_RS11900 (CEG11_11900) tapA 2439703..2440374 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  CEG11_RS11905 (CEG11_11905) - 2440633..2440962 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CEG11_RS11910 (CEG11_11910) - 2441002..2441181 (-) 180 WP_003153093.1 YqzE family protein -
  CEG11_RS11915 (CEG11_11915) comGG 2441238..2441615 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  CEG11_RS11920 (CEG11_11920) comGF 2441616..2442116 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  CEG11_RS11925 (CEG11_11925) comGE 2442025..2442339 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  CEG11_RS11930 (CEG11_11930) comGD 2442323..2442760 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  CEG11_RS11935 (CEG11_11935) comGC 2442750..2443058 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CEG11_RS11940 (CEG11_11940) comGB 2443063..2444100 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  CEG11_RS11945 (CEG11_11945) comGA 2444087..2445157 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CEG11_RS11950 (CEG11_11950) - 2445349..2446299 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  CEG11_RS11955 (CEG11_11955) - 2446445..2447746 (+) 1302 WP_003153081.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16324.85 Da        Isoelectric Point: 10.3725

>NTDB_id=235504 CEG11_RS11930 WP_003153088.1 2442323..2442760(-) (comGD) [Bacillus velezensis strain T20E-257]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPREHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=235504 CEG11_RS11930 WP_003153088.1 2442323..2442760(-) (comGD) [Bacillus velezensis strain T20E-257]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAGAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552


Multiple sequence alignment