Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CEG11_RS11880 | Genome accession | NZ_CP021976 |
| Coordinates | 2437708..2437881 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain T20E-257 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2432708..2442881
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CEG11_RS11865 (CEG11_11865) | gcvT | 2433526..2434626 (-) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CEG11_RS11870 (CEG11_11870) | - | 2435049..2436719 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| CEG11_RS11875 (CEG11_11875) | - | 2436737..2437531 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| CEG11_RS11880 (CEG11_11880) | sinI | 2437708..2437881 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CEG11_RS11885 (CEG11_11885) | sinR | 2437915..2438250 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CEG11_RS11890 (CEG11_11890) | tasA | 2438298..2439083 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| CEG11_RS11895 (CEG11_11895) | sipW | 2439147..2439731 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| CEG11_RS11900 (CEG11_11900) | tapA | 2439703..2440374 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CEG11_RS11905 (CEG11_11905) | - | 2440633..2440962 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| CEG11_RS11910 (CEG11_11910) | - | 2441002..2441181 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CEG11_RS11915 (CEG11_11915) | comGG | 2441238..2441615 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CEG11_RS11920 (CEG11_11920) | comGF | 2441616..2442116 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| CEG11_RS11925 (CEG11_11925) | comGE | 2442025..2442339 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| CEG11_RS11930 (CEG11_11930) | comGD | 2442323..2442760 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=235501 CEG11_RS11880 WP_003153105.1 2437708..2437881(+) (sinI) [Bacillus velezensis strain T20E-257]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=235501 CEG11_RS11880 WP_003153105.1 2437708..2437881(+) (sinI) [Bacillus velezensis strain T20E-257]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |