Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   CD198_RS09660 Genome accession   NZ_CP021966
Coordinates   1906357..1906923 (-) Length   188 a.a.
NCBI ID   WP_002815494.1    Uniprot ID   A0A223XQS1
Organism   Leuconostoc mesenteroides strain CBA7131     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1858181..1922300 1906357..1906923 within 0


Gene organization within MGE regions


Location: 1858181..1922300
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CD198_RS09445 (CD198_09415) - 1859024..1859959 (-) 936 WP_025268537.1 ABC transporter ATP-binding protein -
  CD198_RS09450 (CD198_09420) - 1859962..1861011 (-) 1050 WP_025268538.1 ABC transporter ATP-binding protein -
  CD198_RS09455 (CD198_09425) - 1861026..1862051 (-) 1026 WP_011680475.1 ABC transporter permease -
  CD198_RS09460 (CD198_09430) - 1862063..1862980 (-) 918 WP_011680476.1 ABC transporter permease -
  CD198_RS09465 (CD198_09435) - 1863064..1864698 (-) 1635 WP_025268539.1 peptide ABC transporter substrate-binding protein -
  CD198_RS09470 (CD198_09440) - 1865052..1865711 (-) 660 WP_011680478.1 amino acid ABC transporter permease -
  CD198_RS09475 (CD198_09445) - 1865722..1866363 (-) 642 WP_010288921.1 amino acid ABC transporter permease -
  CD198_RS09480 (CD198_09450) - 1866363..1867229 (-) 867 WP_011680479.1 transporter substrate-binding domain-containing protein -
  CD198_RS09485 (CD198_09455) - 1867321..1868058 (-) 738 WP_002815685.1 amino acid ABC transporter ATP-binding protein -
  CD198_RS09490 (CD198_09460) - 1868242..1870041 (-) 1800 WP_011680480.1 ABC transporter ATP-binding protein -
  CD198_RS09495 (CD198_09465) - 1870025..1871806 (-) 1782 WP_025268540.1 ABC transporter transmembrane domain-containing protein -
  CD198_RS09500 (CD198_09470) - 1871895..1872902 (-) 1008 WP_025268541.1 YdcF family protein -
  CD198_RS09505 (CD198_09475) - 1872990..1874084 (-) 1095 WP_038534140.1 aspartate-semialdehyde dehydrogenase -
  CD198_RS09510 (CD198_09480) alr 1874094..1875206 (-) 1113 WP_025268543.1 alanine racemase -
  CD198_RS09515 (CD198_09485) - 1875599..1876264 (+) 666 WP_010285559.1 NAD(P)H-hydrate epimerase -
  CD198_RS09520 (CD198_09490) - 1876349..1876801 (-) 453 WP_011680485.1 Rrf2 family transcriptional regulator -
  CD198_RS09525 (CD198_09495) - 1876855..1879020 (-) 2166 WP_025268544.1 YhgE/Pip domain-containing protein -
  CD198_RS09530 (CD198_09500) rlmH 1879114..1879593 (-) 480 WP_011680487.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  CD198_RS09535 (CD198_09505) htrA 1880223..1881362 (-) 1140 WP_014325193.1 trypsin-like peptidase domain-containing protein Regulator
  CD198_RS09540 (CD198_09510) yycI 1881423..1882226 (-) 804 WP_010289058.1 two-component system regulatory protein YycI -
  CD198_RS09545 (CD198_09515) - 1882283..1883575 (-) 1293 WP_025268545.1 hypothetical protein -
  CD198_RS09550 (CD198_09520) walK 1883565..1885430 (-) 1866 WP_025268546.1 cell wall metabolism sensor histidine kinase WalK -
  CD198_RS09555 (CD198_09525) yycF 1885498..1886205 (-) 708 WP_010281559.1 response regulator YycF -
  CD198_RS09560 (CD198_09530) - 1886314..1887294 (-) 981 WP_011680491.1 ribose-phosphate diphosphokinase -
  CD198_RS09565 (CD198_09535) tpx 1887399..1887896 (-) 498 WP_002815705.1 thiol peroxidase -
  CD198_RS09570 (CD198_09540) - 1887996..1888808 (-) 813 WP_014325196.1 Cof-type HAD-IIB family hydrolase -
  CD198_RS09575 (CD198_09545) - 1888916..1889428 (-) 513 WP_242979263.1 isocitrate/isopropylmalate family dehydrogenase -
  CD198_RS09580 (CD198_09550) - 1889478..1890395 (-) 918 WP_111303416.1 IS30 family transposase -
  CD198_RS09585 (CD198_09555) - 1890478..1890876 (-) 399 WP_242979264.1 isocitrate/isopropylmalate family dehydrogenase -
  CD198_RS09590 (CD198_09560) - 1890976..1891368 (+) 393 WP_002815709.1 RidA family protein -
  CD198_RS09595 (CD198_09565) ilvA 1891404..1892669 (-) 1266 WP_014325198.1 threonine ammonia-lyase IlvA -
  CD198_RS09600 (CD198_09570) ilvC 1892742..1893785 (-) 1044 WP_025268548.1 ketol-acid reductoisomerase -
  CD198_RS09605 (CD198_09575) - 1893822..1894067 (-) 246 WP_010296022.1 ACT domain-containing protein -
  CD198_RS09610 (CD198_09580) ilvB 1894067..1895779 (-) 1713 WP_025268549.1 biosynthetic-type acetolactate synthase large subunit -
  CD198_RS09615 (CD198_09585) - 1896098..1896889 (+) 792 WP_025268550.1 ABC transporter ATP-binding protein -
  CD198_RS09620 (CD198_09590) - 1897301..1899742 (-) 2442 WP_014325202.1 phosphoketolase family protein -
  CD198_RS09625 (CD198_09595) - 1899929..1900657 (-) 729 WP_011680498.1 GntR family transcriptional regulator -
  CD198_RS09630 (CD198_09600) - 1900735..1901235 (+) 501 WP_025268551.1 aminoacyl-tRNA deacylase -
  CD198_RS09635 (CD198_09605) - 1901228..1901770 (+) 543 WP_025268552.1 hypothetical protein -
  CD198_RS09640 (CD198_09610) dnaB 1901909..1903372 (-) 1464 WP_111303599.1 replicative DNA helicase -
  CD198_RS09645 (CD198_09615) rplI 1903374..1903826 (-) 453 WP_011680501.1 50S ribosomal protein L9 -
  CD198_RS09650 (CD198_09620) - 1903843..1905870 (-) 2028 WP_014325206.1 DHH family phosphoesterase -
  CD198_RS09655 (CD198_09625) rpsR 1906040..1906324 (-) 285 WP_004911134.1 30S ribosomal protein S18 -
  CD198_RS09660 (CD198_09630) ssb 1906357..1906923 (-) 567 WP_002815494.1 single-stranded DNA-binding protein Machinery gene
  CD198_RS09665 (CD198_09635) rpsF 1906957..1907253 (-) 297 WP_011680503.1 30S ribosomal protein S6 -
  CD198_RS09670 (CD198_09640) pepV 1907511..1908941 (-) 1431 WP_025268553.1 dipeptidase PepV -
  CD198_RS09675 (CD198_09645) - 1908938..1909765 (-) 828 WP_011680505.1 energy-coupling factor transporter transmembrane component T -
  CD198_RS09680 (CD198_09650) - 1909767..1911443 (-) 1677 WP_011680506.1 DUF3744 domain-containing protein -
  CD198_RS09685 (CD198_09655) - 1911475..1912038 (-) 564 WP_002815489.1 ECF-type riboflavin transporter substrate-binding protein -
  CD198_RS09690 (CD198_09660) - 1912064..1912924 (-) 861 WP_014325209.1 S-adenosyl-l-methionine hydroxide adenosyltransferase family protein -
  CD198_RS09695 (CD198_09665) recQ 1913277..1915085 (-) 1809 WP_025268554.1 DNA helicase RecQ -
  CD198_RS09700 (CD198_09670) - 1915132..1915590 (-) 459 WP_025268555.1 hypothetical protein -
  CD198_RS09705 (CD198_09675) - 1915990..1916577 (-) 588 WP_220457714.1 helix-turn-helix transcriptional regulator -
  CD198_RS09710 (CD198_09680) - 1916669..1917009 (-) 341 Protein_1869 hypothetical protein -
  CD198_RS09715 (CD198_09685) - 1917022..1917894 (-) 873 WP_025268557.1 hypothetical protein -
  CD198_RS09720 (CD198_09690) - 1918034..1918321 (-) 288 WP_010280513.1 bacteriocin immunity protein -
  CD198_RS09725 (CD198_09695) - 1918426..1918626 (-) 201 WP_010280515.1 helix-turn-helix transcriptional regulator -
  CD198_RS09730 (CD198_09700) - 1918637..1918948 (-) 312 WP_025268558.1 hypothetical protein -
  CD198_RS09735 (CD198_09705) - 1919281..1919625 (-) 345 WP_025268559.1 hypothetical protein -
  CD198_RS10885 - 1919748..1919903 (+) 156 WP_014325216.1 hypothetical protein -
  CD198_RS09740 (CD198_09710) - 1920305..1920493 (-) 189 WP_223825242.1 hypothetical protein -
  CD198_RS11065 - 1920681..1920878 (-) 198 WP_014325218.1 hypothetical protein -
  CD198_RS09750 (CD198_09720) - 1921019..1921387 (-) 369 WP_014325219.1 hypothetical protein -

Sequence

Protein


Download         Length: 188 a.a.        Molecular weight: 20159.69 Da        Isoelectric Point: 4.5478

>NTDB_id=235309 CD198_RS09660 WP_002815494.1 1906357..1906923(-) (ssb) [Leuconostoc mesenteroides strain CBA7131]
MINRVVLIGRLTRDVELRYTQSGVAVGTFSLAVNRQFTNASGEREADFINAVIWRKAAENFANFTGKGALVAVEGRLQTR
NYENNAGQRVYVTEVVVDNFSLLESRAESEKRRSQNGSSASNNGADNFSGSNDHSFGGNDNSFNGVDPFASASSNSNTQS
SASSNSAPNPFAASGNTEIDISDDDLPF

Nucleotide


Download         Length: 567 bp        

>NTDB_id=235309 CD198_RS09660 WP_002815494.1 1906357..1906923(-) (ssb) [Leuconostoc mesenteroides strain CBA7131]
ATGATTAATCGAGTAGTATTAATTGGGCGATTGACCCGTGATGTTGAATTACGTTACACACAATCAGGTGTAGCAGTCGG
TACGTTTAGCTTGGCGGTTAACCGTCAGTTCACCAACGCAAGTGGTGAACGTGAAGCTGACTTTATTAACGCCGTTATTT
GGCGAAAAGCAGCTGAAAACTTTGCAAACTTCACTGGAAAAGGTGCACTTGTGGCCGTTGAAGGTCGTTTACAAACAAGA
AATTATGAAAATAATGCTGGCCAACGCGTTTACGTGACGGAAGTTGTTGTTGATAATTTCTCATTACTCGAATCTCGCGC
TGAAAGTGAAAAGCGTCGTTCTCAGAACGGATCATCGGCATCTAATAATGGTGCTGACAACTTCAGCGGATCAAACGATC
ATTCGTTTGGCGGTAATGACAACTCATTTAACGGTGTTGATCCTTTTGCAAGTGCGAGTTCAAACTCAAATACGCAATCA
TCAGCTTCGTCAAATAGTGCCCCTAATCCATTTGCGGCTAGTGGCAATACAGAAATTGATATATCAGATGATGATTTACC
ATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A223XQS1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

62.766

100

0.628
  ssbA Bacillus subtilis subsp. subtilis str. 168

51.596

100

0.516

Multiple sequence alignment