Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S101392_RS16490 Genome accession   NZ_CP021921
Coordinates   3179231..3179371 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain SRCM101392     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3174231..3184371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101392_RS16465 (S101392_03266) yuxO 3174581..3174961 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  S101392_RS16470 (S101392_03267) comA 3174980..3175624 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  S101392_RS16475 (S101392_03268) comP 3175705..3178002 (-) 2298 WP_088326847.1 histidine kinase Regulator
  S101392_RS16480 (S101392_03269) comX 3178010..3178171 (-) 162 WP_049140565.1 competence pheromone ComX -
  S101392_RS16485 (S101392_03270) - 3178186..3179046 (-) 861 WP_088326849.1 polyprenyl synthetase family protein -
  S101392_RS16490 (S101392_03271) degQ 3179231..3179371 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  S101392_RS21565 - 3179593..3179718 (+) 126 WP_003228793.1 hypothetical protein -
  S101392_RS16495 (S101392_03272) - 3179834..3180202 (+) 369 WP_050258610.1 hypothetical protein -
  S101392_RS16500 (S101392_03273) pdeH 3180178..3181407 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  S101392_RS16505 (S101392_03274) pncB 3181544..3183016 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  S101392_RS16510 (S101392_03275) pncA 3183032..3183583 (-) 552 WP_088326850.1 isochorismatase family cysteine hydrolase -
  S101392_RS16515 (S101392_03276) yueI 3183680..3184078 (-) 399 WP_088326852.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=234988 S101392_RS16490 WP_003220708.1 3179231..3179371(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM101392]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=234988 S101392_RS16490 WP_003220708.1 3179231..3179371(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM101392]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment