Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S101395_RS20220 Genome accession   NZ_CP021920
Coordinates   3832392..3832532 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sonorensis strain SRCM101395     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3827392..3837532
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101395_RS20195 (S101395_04073) - 3827690..3828082 (-) 393 WP_006638892.1 hotdog fold thioesterase -
  S101395_RS20200 (S101395_04074) comA 3828101..3828739 (-) 639 WP_006638893.1 response regulator transcription factor Regulator
  S101395_RS20205 - 3828821..3831132 (-) 2312 Protein_4005 ATP-binding protein -
  S101395_RS20210 (S101395_04077) comX 3831147..3831320 (-) 174 WP_006638895.1 competence pheromone ComX -
  S101395_RS20215 (S101395_04078) - 3831304..3832203 (-) 900 WP_006638896.1 polyprenyl synthetase family protein -
  S101395_RS20220 (S101395_04079) degQ 3832392..3832532 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  S101395_RS20230 (S101395_04080) - 3833039..3833365 (+) 327 WP_006638897.1 hypothetical protein -
  S101395_RS20235 (S101395_04081) - 3833412..3834629 (-) 1218 WP_006638898.1 EAL and HDOD domain-containing protein -
  S101395_RS20240 (S101395_04082) - 3834816..3836279 (-) 1464 WP_006638899.1 nicotinate phosphoribosyltransferase -
  S101395_RS20245 (S101395_04083) - 3836297..3836848 (-) 552 WP_006638900.1 cysteine hydrolase family protein -
  S101395_RS20250 (S101395_04084) - 3836986..3837387 (-) 402 WP_006638901.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=234917 S101395_RS20220 WP_003184860.1 3832392..3832532(-) (degQ) [Bacillus sonorensis strain SRCM101395]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=234917 S101395_RS20220 WP_003184860.1 3832392..3832532(-) (degQ) [Bacillus sonorensis strain SRCM101395]
GTGGAAAAGCAACAAATTGAAGAGTTAAAGCAATTACTCTGGCGGCTTGAAAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATCGATCAGTACGACAAGTACACATATTTAAAAACCTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment