Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   S101395_RS09685 Genome accession   NZ_CP021920
Coordinates   1812676..1812849 (-) Length   57 a.a.
NCBI ID   WP_006637527.1    Uniprot ID   -
Organism   Bacillus sonorensis strain SRCM101395     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1807676..1817849
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101395_RS09640 (S101395_01957) comGE 1807944..1808291 (+) 348 WP_006637536.1 competence type IV pilus minor pilin ComGE -
  S101395_RS09645 (S101395_01958) comGF 1808200..1808691 (+) 492 WP_224254419.1 competence type IV pilus minor pilin ComGF -
  S101395_RS09650 (S101395_01959) comGG 1808746..1809069 (+) 324 WP_224254418.1 competence type IV pilus minor pilin ComGG -
  S101395_RS09655 (S101395_01960) - 1809149..1809334 (+) 186 WP_006637533.1 YqzE family protein -
  S101395_RS09660 (S101395_01961) - 1809428..1809748 (-) 321 WP_006637532.1 DUF3889 domain-containing protein -
  S101395_RS09665 (S101395_01962) tapA 1810011..1810757 (+) 747 WP_006637531.1 amyloid fiber anchoring/assembly protein TapA -
  S101395_RS09670 (S101395_01963) sipW 1810754..1811335 (+) 582 WP_006637530.1 signal peptidase I SipW -
  S101395_RS09675 (S101395_01964) tasA 1811405..1812199 (+) 795 WP_006637529.1 biofilm matrix protein TasA -
  S101395_RS09680 (S101395_01965) sinR 1812307..1812642 (-) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  S101395_RS09685 (S101395_01966) sinI 1812676..1812849 (-) 174 WP_006637527.1 anti-repressor SinI Regulator
  S101395_RS09690 (S101395_01967) - 1813039..1813833 (-) 795 WP_006637526.1 YqhG family protein -
  S101395_RS09695 (S101395_01968) - 1813837..1815516 (-) 1680 WP_006637525.1 DEAD/DEAH box helicase -
  S101395_RS09700 (S101395_01969) gcvT 1816103..1817197 (+) 1095 WP_006637524.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6504.38 Da        Isoelectric Point: 5.6746

>NTDB_id=234890 S101395_RS09685 WP_006637527.1 1812676..1812849(-) (sinI) [Bacillus sonorensis strain SRCM101395]
MKAKSEKEELDKEWEDLIKSALRAGISPEEIRIFLNLGHKPSEASTPIERSHSINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=234890 S101395_RS09685 WP_006637527.1 1812676..1812849(-) (sinI) [Bacillus sonorensis strain SRCM101395]
ATGAAAGCGAAAAGTGAGAAGGAAGAATTGGACAAGGAGTGGGAAGATCTCATCAAAAGCGCTCTCAGAGCAGGTATTAG
TCCAGAGGAAATAAGAATTTTTCTCAATTTGGGTCATAAGCCTTCGGAAGCTTCCACACCAATTGAAAGAAGTCATTCAA
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(10-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

52.727

96.491

0.509


Multiple sequence alignment