Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   CD017_RS04760 Genome accession   NZ_CP021905
Coordinates   970993..971562 (-) Length   189 a.a.
NCBI ID   WP_000287265.1    Uniprot ID   A0A7U7EXU5
Organism   Staphylococcus aureus strain Seattle 1945 isolate G477     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 971664..1008341 970993..971562 flank 102


Gene organization within MGE regions


Location: 970993..1008341
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CD017_RS04760 comK/comK1 970993..971562 (-) 570 WP_000287265.1 competence protein ComK Regulator
  CD017_RS04765 - 971772..971990 (+) 219 WP_000876825.1 IDEAL domain-containing protein -
  CD017_RS04770 - 972071..973057 (-) 987 WP_000668822.1 lipoate--protein ligase -
  CD017_RS04775 - 973256..973432 (+) 177 WP_000214898.1 YkvS family protein -
  CD017_RS04780 - 973447..974049 (+) 603 WP_001033867.1 type II CAAX prenyl endopeptidase Rce1 family protein -
  CD017_RS14730 - 974365..974427 (+) 63 WP_240785570.1 putative holin-like toxin -
  CD017_RS04790 - 974966..975067 (+) 102 WP_001790623.1 hypothetical protein -
  CD017_RS04795 - 975077..975349 (+) 273 WP_001794574.1 lactococcin 972 family bacteriocin -
  CD017_RS04800 - 975393..977357 (+) 1965 WP_000870820.1 bacteriocin-associated integral membrane family protein -
  CD017_RS04805 - 977360..977680 (+) 321 WP_000873929.1 YxeA family protein -
  CD017_RS04810 - 977677..978318 (+) 642 WP_000571183.1 ABC transporter ATP-binding protein -
  CD017_RS04815 - 978406..978696 (-) 291 WP_001791476.1 hypothetical protein -
  CD017_RS04820 - 979037..979324 (+) 288 WP_000410718.1 hypothetical protein -
  CD017_RS04825 - 979330..980811 (+) 1482 WP_000719183.1 glycosyltransferase -
  CD017_RS04830 - 980901..981257 (-) 357 WP_000766009.1 DoxX family protein -
  CD017_RS04835 - 981748..982470 (+) 723 Protein_908 ABC transporter substrate-binding protein -
  CD017_RS04840 - 982524..982808 (+) 285 WP_000134551.1 hypothetical protein -
  CD017_RS04845 - 982959..983279 (+) 321 WP_000805733.1 DUF961 family protein -
  CD017_RS04850 - 983293..983595 (+) 303 WP_000386891.1 hypothetical protein -
  CD017_RS04855 - 983770..984861 (+) 1092 WP_000172936.1 replication initiation factor domain-containing protein -
  CD017_RS04860 - 984922..985989 (+) 1068 WP_000692013.1 conjugal transfer protein -
  CD017_RS04865 - 985994..986254 (+) 261 WP_000015640.1 TcpD family membrane protein -
  CD017_RS04870 - 986266..986649 (+) 384 WP_000358144.1 TcpE family conjugal transfer membrane protein -
  CD017_RS04875 - 986684..989179 (+) 2496 WP_001049264.1 ATP-binding protein -
  CD017_RS04880 - 989233..990591 (+) 1359 WP_001251204.1 FtsK/SpoIIIE domain-containing protein -
  CD017_RS04885 - 990596..992443 (+) 1848 WP_000681144.1 CD3337/EF1877 family mobilome membrane protein -
  CD017_RS04890 - 992433..993479 (+) 1047 WP_000247481.1 CHAP domain-containing protein -
  CD017_RS04895 - 993486..994076 (+) 591 WP_000810442.1 hypothetical protein -
  CD017_RS04900 - 994132..994473 (+) 342 WP_001255377.1 cystatin-like fold lipoprotein -
  CD017_RS14415 - 994582..995085 (+) 504 WP_000746374.1 transposase -
  CD017_RS14420 - 995114..995602 (+) 489 WP_232471205.1 IS30 family transposase -
  CD017_RS04910 - 995816..996061 (+) 246 Protein_924 ABC transporter substrate-binding protein -
  CD017_RS04915 - 996108..996239 (-) 132 WP_001794249.1 SAR1012 family small protein -
  CD017_RS04920 - 996303..996518 (-) 216 WP_000867359.1 TM2 domain-containing protein -
  CD017_RS04925 - 996683..997234 (+) 552 WP_000620943.1 GNAT family N-acetyltransferase -
  CD017_RS04930 - 997286..998224 (-) 939 WP_000070966.1 1,4-dihydroxy-2-naphthoate polyprenyltransferase -
  CD017_RS14635 - 998375..998452 (+) 78 WP_072357920.1 hypothetical protein -
  CD017_RS04940 - 998445..999767 (+) 1323 WP_223200472.1 isochorismate synthase -
  CD017_RS04945 menD 999754..1001427 (+) 1674 WP_000526678.1 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase -
  CD017_RS04950 menH 1001414..1002217 (+) 804 WP_000150205.1 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase -
  CD017_RS04955 menB 1002210..1003031 (+) 822 WP_000184947.1 1,4-dihydroxy-2-naphthoyl-CoA synthase -
  CD017_RS04960 sspC 1003267..1003596 (-) 330 WP_000284455.1 staphostatin B -
  CD017_RS04965 sspB 1003634..1004815 (-) 1182 WP_001088793.1 cysteine protease staphopain B -
  CD017_RS04970 sspA 1004897..1005970 (-) 1074 WP_000676568.1 Glu-specific serine endopeptidase SspA -
  CD017_RS04980 - 1006498..1007652 (-) 1155 WP_000777562.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -

Sequence


Protein


Download         Length: 189 a.a.        Molecular weight: 22601.83 Da        Isoelectric Point: 9.6091

>NTDB_id=234671 CD017_RS04760 WP_000287265.1 970993..971562(-) (comK/comK1) [Staphylococcus aureus strain Seattle 1945 isolate G477]
MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTYLGKKAETNRITGISSKPPIL
LTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCKVTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMIS
KNPDQPIDYNKATLNVFEALTRYSLFEDK

Nucleotide


Download         Length: 570 bp        

>NTDB_id=234671 CD017_RS04760 WP_000287265.1 970993..971562(-) (comK/comK1) [Staphylococcus aureus strain Seattle 1945 isolate G477]
ATGTATTCTCAAAATATTTATGTGATACGCAAAGGAGACATGGTTATTCGACCAGCATTTGATGATGACGATCAAAGAAA
TGGTAGTGAAATAATTCGGTTTGACAAAACGCGTATTCAAAATCCTTTTAAAGTCCAGAAAATCATTGAACGCTCTTGCA
AATTTTATGGTAATACTTATCTTGGCAAGAAAGCAGAGACAAACCGCATTACTGGCATTTCTAGTAAACCACCTATTTTA
CTAACACCATTATTTCCAACTTATTTTTTCCCAACACATTCTGACAGACAAAATGAAAATATTTGGTTAAATATGCATTA
TATCGAAAGTATTAAAGAATTAAAAAATCGTAAATGTAAAGTGACATTTATTAATAATGAATCAATCATTCTTCATGTTT
CATACCACAGTTTATGGCACCAATATAACAATTCCATTTTTTACTATTACATGGTAGATAAACAATCTCGCATGATATCA
AAAAATCCCGACCAACCAATAGATTATAATAAAGCCACATTGAATGTGTTTGAAGCATTGACACGCTATTCTTTATTTGA
AGATAAATAA

Domains


Predicted by InterproScan.

(5-156)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7EXU5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

100

100

1

  comK/comK1 Staphylococcus aureus N315

100

100

1


Multiple sequence alignment