Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CCZ24_RS07550 | Genome accession | NZ_CP021773 |
| Coordinates | 1509904..1510092 (-) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain B105 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1510548..1519321 | 1509904..1510092 | flank | 456 |
| IS/Tn | 1510548..1511159 | 1509904..1510092 | flank | 456 |
Gene organization within MGE regions
Location: 1509904..1519321
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CCZ24_RS07550 (CCZ24_07435) | prx | 1509904..1510092 (-) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| CCZ24_RS07555 (CCZ24_07440) | - | 1510134..1510334 (-) | 201 | WP_000076708.1 | CsbD family protein | - |
| CCZ24_RS07560 (CCZ24_07445) | - | 1510512..1511159 (+) | 648 | Protein_1442 | IS3 family transposase | - |
| CCZ24_RS07565 (CCZ24_07450) | - | 1511211..1512530 (-) | 1320 | WP_000734167.1 | HAMP domain-containing sensor histidine kinase | - |
| CCZ24_RS07570 (CCZ24_07455) | - | 1512527..1513180 (-) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| CCZ24_RS07575 (CCZ24_07460) | - | 1513277..1514653 (-) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| CCZ24_RS07580 (CCZ24_07465) | - | 1514653..1515309 (-) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| CCZ24_RS07585 (CCZ24_07470) | - | 1515319..1516596 (-) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| CCZ24_RS07590 (CCZ24_07475) | - | 1517338..1517499 (+) | 162 | WP_000508795.1 | NINE protein | - |
| CCZ24_RS12085 | - | 1517672..1519034 (-) | 1363 | Protein_1449 | IS3 family transposase | - |
| CCZ24_RS07615 (CCZ24_07490) | - | 1519055..1519321 (+) | 267 | WP_001872365.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=233354 CCZ24_RS07550 WP_000027835.1 1509904..1510092(-) (prx) [Streptococcus agalactiae strain B105]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=233354 CCZ24_RS07550 WP_000027835.1 1509904..1510092(-) (prx) [Streptococcus agalactiae strain B105]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |