Detailed information NTG0232928

Bioinformatically predicted

Overview

• Name: pilR
• Type: Regulator
• Locus tag: CDA09_RS19185
• Genome accession: NZ_CP021731
• Coordinates: 4136201..4136302 (-)
• Length: 33 a.a.
• NCBI ID: WP_121430946.1
• Uniprot ID: -
• Organism: Azoarcus sp. DN11
• Function: regulate pilin expression (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4131309..4140485	4136201..4136302	within	0

Gene organization within MGE regions

Location: 4131309..4140485

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CDA09_RS19120 (CDA09_19095)	-	4131309..4131608 (-)	300	WP_164844442.1	nucleotidyltransferase domain-containing protein	-
CDA09_RS19125 (CDA09_19100)	-	4131822..4132235 (-)	414	WP_121430100.1	putative toxin-antitoxin system toxin component, PIN family	-
CDA09_RS19130 (CDA09_19105)	-	4132228..4132476 (-)	249	WP_121430101.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
CDA09_RS19135 (CDA09_19110)	-	4132712..4133017 (+)	306	WP_286164247.1	nucleotidyltransferase domain-containing protein	-
CDA09_RS19145 (CDA09_19120)	-	4133215..4133478 (-)	264	WP_121430102.1	type II toxin-antitoxin system RelE/ParE family toxin	-
CDA09_RS19150 (CDA09_19125)	-	4133465..4133698 (-)	234	WP_121430103.1	ribbon-helix-helix protein, CopG family	-
CDA09_RS19155 (CDA09_19130)	-	4133889..4134275 (-)	387	WP_121430104.1	type II toxin-antitoxin system VapC family toxin	-
CDA09_RS19160 (CDA09_19135)	-	4134272..4134520 (-)	249	WP_121430105.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
CDA09_RS19170 (CDA09_19145)	tapA	4134855..4135271 (+)	417	WP_121430945.1	type IVa pilus major pilin TapA	-
CDA09_RS19175 (CDA09_19150)	-	4135581..4135814 (+)	234	WP_121430107.1	type II toxin-antitoxin system prevent-host-death family antitoxin	-
CDA09_RS19180 (CDA09_19155)	-	4135811..4136197 (+)	387	WP_121430108.1	type II toxin-antitoxin system VapC family toxin	-
CDA09_RS19185	pilR	4136201..4136302 (-)	102	WP_121430946.1	helix-turn-helix domain-containing protein	Regulator
CDA09_RS19190 (CDA09_19165)	-	4136520..4136801 (+)	282	WP_121430947.1	type II toxin-antitoxin system ParD family antitoxin	-
CDA09_RS19195 (CDA09_19170)	-	4136801..4137127 (+)	327	WP_121430109.1	type II toxin-antitoxin system RelE/ParE family toxin	-
CDA09_RS19200 (CDA09_19175)	-	4137312..4137557 (+)	246	WP_121430110.1	hypothetical protein	-
CDA09_RS19205 (CDA09_19180)	-	4137562..4137960 (+)	399	WP_121430111.1	type II toxin-antitoxin system VapC family toxin	-
CDA09_RS19210 (CDA09_19185)	-	4138147..4138476 (+)	330	WP_121430112.1	addiction module antidote protein	-
CDA09_RS19215 (CDA09_19190)	-	4138606..4139709 (+)	1104	WP_121430113.1	transposase	-
CDA09_RS19220 (CDA09_19195)	-	4139818..4140081 (+)	264	WP_217351263.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
CDA09_RS19225 (CDA09_19200)	-	4140078..4140485 (+)	408	WP_121430114.1	type II toxin-antitoxin system VapC family toxin	-

Sequence

Protein

• Length: 33 a.a.
• Molecular weight: 4138.80 Da
• Isoelectric Point: 11.7778

>NTDB_id=232928 CDA09_RS19185 WP_121430946.1 4136201..4136302(-) (pilR) [Azoarcus sp. DN11]
MLDDTRWNRSEAARRLGMTLRQLRYRLQKWGME

Nucleotide

• Length: 102 bp

>NTDB_id=232928 CDA09_RS19185 WP_121430946.1 4136201..4136302(-) (pilR) [Azoarcus sp. DN11]
ATGCTCGACGACACACGCTGGAACCGCTCGGAAGCCGCGCGGCGCCTGGGGATGACGCTCAGGCAGTTGCGTTACCGGCT
GCAGAAGTGGGGGATGGAGTAG

Domains

Predicted by InterproScan.

• Bacterial regulatory protein, Fis family (HTH_8) (2-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilR	Pseudomonas aeruginosa PAK	59.375	96.97	0.576
pilR	Acinetobacter baumannii strain A118	59.375	96.97	0.576