Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BL14DL4_RS08065 | Genome accession | NZ_CP026673 |
| Coordinates | 1459450..1459590 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain 14ADL4 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1454450..1464590
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BL14DL4_RS08040 (BL14DL4_01606) | - | 1454747..1455136 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| BL14DL4_RS08045 (BL14DL4_01607) | comA | 1455153..1455791 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| BL14DL4_RS08050 (BL14DL4_01608) | comP | 1455878..1458184 (-) | 2307 | WP_025807478.1 | ATP-binding protein | Regulator |
| BL14DL4_RS08055 (BL14DL4_01609) | comX | 1458207..1458371 (-) | 165 | WP_003184853.1 | competence pheromone ComX | - |
| BL14DL4_RS08060 (BL14DL4_01610) | comQ | 1458380..1459261 (-) | 882 | WP_003184856.1 | polyprenyl synthetase family protein | Regulator |
| BL14DL4_RS08065 (BL14DL4_01611) | degQ | 1459450..1459590 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| BL14DL4_RS08075 (BL14DL4_01613) | - | 1460076..1460423 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| BL14DL4_RS08080 (BL14DL4_01614) | - | 1460466..1461686 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| BL14DL4_RS08085 (BL14DL4_01615) | - | 1461865..1463334 (-) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| BL14DL4_RS08090 (BL14DL4_01616) | - | 1463352..1463903 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| BL14DL4_RS08095 (BL14DL4_01617) | - | 1464088..1464489 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=227934 BL14DL4_RS08065 WP_003184860.1 1459450..1459590(-) (degQ) [Bacillus licheniformis strain 14ADL4]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=227934 BL14DL4_RS08065 WP_003184860.1 1459450..1459590(-) (degQ) [Bacillus licheniformis strain 14ADL4]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |