Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   B6257_RS05290 Genome accession   NZ_CP021011
Coordinates   1005993..1006133 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GFP-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1000993..1011133
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B6257_RS05265 (B6257_05245) - 1001290..1001673 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  B6257_RS05270 (B6257_05250) comA 1001695..1002339 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  B6257_RS05275 (B6257_05255) comP 1002420..1004723 (-) 2304 WP_101562386.1 histidine kinase Regulator
  B6257_RS05285 (B6257_05265) comQ 1004876..1005808 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  B6257_RS05290 (B6257_05270) degQ 1005993..1006133 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  B6257_RS05295 (B6257_05275) - 1006598..1006939 (+) 342 WP_014305721.1 hypothetical protein -
  B6257_RS05300 (B6257_05280) - 1006946..1008166 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  B6257_RS05305 (B6257_05285) - 1008296..1009762 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  B6257_RS05310 (B6257_05290) - 1009780..1010331 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  B6257_RS05315 (B6257_05295) - 1010428..1010826 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=227799 B6257_RS05290 WP_003152043.1 1005993..1006133(-) (degQ) [Bacillus velezensis strain GFP-2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=227799 B6257_RS05290 WP_003152043.1 1005993..1006133(-) (degQ) [Bacillus velezensis strain GFP-2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment