Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   C4N11_RS02550 Genome accession   NZ_CP026670
Coordinates   472394..472543 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain endophthalmitis isolate 335     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 467394..477543
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C4N11_RS02520 (C4N11_02520) comA/nlmT 468461..470137 (-) 1677 WP_196300924.1 peptide cleavage/export ABC transporter Regulator
  C4N11_RS12865 comA/nlmT 470031..470618 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  C4N11_RS02525 (C4N11_02525) blpI 470900..471097 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  C4N11_RS02535 (C4N11_02535) blpJ 471564..471833 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  C4N11_RS02540 (C4N11_02540) blpK 471902..472150 (+) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  C4N11_RS02550 (C4N11_02550) cipB 472394..472543 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  C4N11_RS02555 (C4N11_02555) - 472647..472766 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  C4N11_RS02565 (C4N11_02565) - 473286..473605 (+) 320 Protein_478 immunity protein -
  C4N11_RS02575 (C4N11_02575) - 474234..474617 (+) 384 WP_000877381.1 hypothetical protein -
  C4N11_RS02580 (C4N11_02580) - 474669..475358 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  C4N11_RS02585 (C4N11_02585) blpZ 475400..475633 (+) 234 WP_000276498.1 immunity protein BlpZ -
  C4N11_RS02595 (C4N11_02595) - 475784..476395 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  C4N11_RS02600 (C4N11_02600) ccrZ 476556..477350 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=227788 C4N11_RS02550 WP_001809846.1 472394..472543(+) (cipB) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=227788 C4N11_RS02550 WP_001809846.1 472394..472543(+) (cipB) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment