Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   B9L64_RS08295 Genome accession   NZ_CP020915
Coordinates   1619945..1620085 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 50-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1614945..1625085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9L64_RS08270 yuxO 1615222..1615602 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  B9L64_RS08275 comA 1615621..1616265 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  B9L64_RS08280 comP 1616346..1618658 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  B9L64_RS08285 comX 1618674..1618895 (-) 222 WP_014480704.1 competence pheromone ComX -
  B9L64_RS08290 - 1618897..1619760 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  B9L64_RS08295 degQ 1619945..1620085 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  B9L64_RS21030 - 1620307..1620432 (+) 126 WP_003228793.1 hypothetical protein -
  B9L64_RS08300 - 1620547..1620915 (+) 369 WP_046381300.1 hypothetical protein -
  B9L64_RS08305 pdeH 1620891..1622120 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  B9L64_RS08310 pncB 1622257..1623729 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  B9L64_RS08315 pncA 1623745..1624296 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  B9L64_RS08320 yueI 1624393..1624791 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=227081 B9L64_RS08295 WP_003220708.1 1619945..1620085(-) (degQ) [Bacillus subtilis strain 50-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=227081 B9L64_RS08295 WP_003220708.1 1619945..1620085(-) (degQ) [Bacillus subtilis strain 50-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment