Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   B9L64_RS04585 Genome accession   NZ_CP020915
Coordinates   938379..938552 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain 50-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 933379..943552
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9L64_RS04570 gcvT 934179..935267 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  B9L64_RS04575 hepAA 935708..937381 (+) 1674 WP_029726726.1 SNF2-related protein -
  B9L64_RS04580 yqhG 937402..938196 (+) 795 WP_015714249.1 YqhG family protein -
  B9L64_RS04585 sinI 938379..938552 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  B9L64_RS04590 sinR 938586..938921 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  B9L64_RS04595 tasA 939014..939799 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  B9L64_RS04600 sipW 939863..940435 (-) 573 WP_072692741.1 signal peptidase I SipW -
  B9L64_RS04605 tapA 940419..941180 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  B9L64_RS04610 yqzG 941452..941778 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  B9L64_RS04615 spoIITA 941820..941999 (-) 180 WP_029726723.1 YqzE family protein -
  B9L64_RS04620 comGG 942071..942445 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  B9L64_RS04625 comGF 942446..942829 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  B9L64_RS04630 comGE 942855..943202 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=227057 B9L64_RS04585 WP_003230187.1 938379..938552(+) (sinI) [Bacillus subtilis strain 50-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=227057 B9L64_RS04585 WP_003230187.1 938379..938552(+) (sinI) [Bacillus subtilis strain 50-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment