Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | B9C53_RS14890 | Genome accession | NZ_CP020874 |
| Coordinates | 3079208..3079348 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain GYL4 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3074208..3084348
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B9C53_RS14860 (B9C53_14810) | - | 3074511..3074909 (+) | 399 | WP_003152031.1 | YueI family protein | - |
| B9C53_RS14865 (B9C53_14815) | - | 3075006..3075557 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| B9C53_RS14870 (B9C53_14820) | - | 3075575..3077041 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| B9C53_RS14875 (B9C53_14825) | - | 3077171..3078394 (+) | 1224 | WP_108654978.1 | EAL and HDOD domain-containing protein | - |
| B9C53_RS14880 (B9C53_14830) | - | 3078401..3078742 (-) | 342 | WP_038459666.1 | hypothetical protein | - |
| B9C53_RS14890 (B9C53_14840) | degQ | 3079208..3079348 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| B9C53_RS14895 (B9C53_14845) | - | 3079500..3080411 (+) | 912 | WP_079891857.1 | polyprenyl synthetase family protein | - |
| B9C53_RS14900 (B9C53_14850) | comX | 3080411..3080575 (+) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| B9C53_RS14905 (B9C53_14855) | comP | 3080587..3082878 (+) | 2292 | WP_101669783.1 | histidine kinase | Regulator |
| B9C53_RS14910 (B9C53_14860) | comA | 3082959..3083603 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| B9C53_RS14915 (B9C53_14865) | - | 3083625..3084008 (+) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=226787 B9C53_RS14890 WP_003152043.1 3079208..3079348(+) (degQ) [Bacillus velezensis strain GYL4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=226787 B9C53_RS14890 WP_003152043.1 3079208..3079348(+) (degQ) [Bacillus velezensis strain GYL4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |