Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   A6J51_RS12330 Genome accession   NZ_CP020423
Coordinates   2084847..2085344 (-) Length   165 a.a.
NCBI ID   WP_192941139.1    Uniprot ID   -
Organism   Neisseria meningitidis strain FDAARGOS_212     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2042814..2099449 2084847..2085344 within 0


Gene organization within MGE regions


Location: 2042814..2099449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A6J51_RS12035 (A6J51_11685) - 2042814..2043182 (+) 369 WP_002217436.1 type II toxin-antitoxin system death-on-curing family toxin -
  A6J51_RS14255 - 2043198..2043368 (+) 171 WP_009345133.1 hypothetical protein -
  A6J51_RS12040 (A6J51_11690) - 2043620..2044111 (+) 492 WP_080611316.1 DUF4760 domain-containing protein -
  A6J51_RS12045 (A6J51_11695) - 2044470..2044706 (+) 237 WP_002222638.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  A6J51_RS12050 (A6J51_11700) - 2044708..2045055 (+) 348 WP_002217440.1 type II toxin-antitoxin system PemK/MazF family toxin -
  A6J51_RS12055 (A6J51_11705) - 2045108..2045617 (-) 510 WP_164730179.1 hypothetical protein -
  A6J51_RS12060 (A6J51_11710) - 2045629..2046102 (-) 474 WP_002217442.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  A6J51_RS12065 (A6J51_11715) - 2046241..2046516 (-) 276 WP_002217443.1 hypothetical protein -
  A6J51_RS12070 (A6J51_11720) - 2046513..2046938 (-) 426 WP_002217444.1 hypothetical protein -
  A6J51_RS12075 (A6J51_11725) - 2047002..2047373 (-) 372 WP_002217445.1 hypothetical protein -
  A6J51_RS14760 (A6J51_11730) - 2047441..2047647 (-) 207 WP_002217448.1 hypothetical protein -
  A6J51_RS12085 (A6J51_11735) - 2047664..2048110 (-) 447 WP_002241437.1 hypothetical protein -
  A6J51_RS12090 (A6J51_11740) - 2048181..2052446 (-) 4266 WP_080611318.1 phage tail protein -
  A6J51_RS12095 (A6J51_11745) - 2052582..2053304 (-) 723 WP_080611319.1 tail assembly protein -
  A6J51_RS12100 (A6J51_11750) - 2053307..2054056 (-) 750 WP_080611320.1 C40 family peptidase -
  A6J51_RS12105 (A6J51_11755) - 2054053..2054775 (-) 723 WP_002247810.1 phage minor tail protein L -
  A6J51_RS12110 (A6J51_11760) - 2054835..2055104 (-) 270 WP_002217457.1 phage tail protein -
  A6J51_RS12115 (A6J51_11765) - 2055126..2058344 (-) 3219 WP_002224445.1 phage tail length tape measure family protein -
  A6J51_RS12120 (A6J51_11770) - 2058337..2058609 (-) 273 WP_002220710.1 DUF1799 domain-containing protein -
  A6J51_RS12125 (A6J51_11775) - 2058657..2058968 (-) 312 WP_002220709.1 phage tail assembly chaperone -
  A6J51_RS12130 (A6J51_11780) - 2059032..2059673 (-) 642 WP_002220708.1 phage tail protein -
  A6J51_RS12135 (A6J51_11785) - 2059705..2060124 (-) 420 WP_002244524.1 hypothetical protein -
  A6J51_RS12140 (A6J51_11790) - 2060105..2060407 (-) 303 WP_002244523.1 hypothetical protein -
  A6J51_RS12145 (A6J51_11795) - 2060400..2060627 (-) 228 WP_002220705.1 hypothetical protein -
  A6J51_RS12150 (A6J51_11800) - 2060685..2062577 (-) 1893 WP_002220704.1 phage major capsid protein -
  A6J51_RS12155 (A6J51_11805) - 2062558..2064120 (-) 1563 WP_002245549.1 phage portal protein -
  A6J51_RS12160 (A6J51_11810) - 2064129..2064383 (-) 255 WP_002220702.1 hypothetical protein -
  A6J51_RS12165 (A6J51_11815) - 2064370..2064756 (-) 387 WP_002220701.1 DUF3310 domain-containing protein -
  A6J51_RS12170 (A6J51_11820) - 2064759..2064968 (-) 210 WP_002220700.1 hypothetical protein -
  A6J51_RS12175 (A6J51_11825) - 2064985..2067831 (-) 2847 WP_002220699.1 primase-helicase family protein -
  A6J51_RS12180 (A6J51_11830) - 2067946..2068293 (-) 348 WP_002220698.1 hypothetical protein -
  A6J51_RS12190 (A6J51_11840) - 2068693..2069409 (+) 717 WP_002220696.1 helix-turn-helix transcriptional regulator -
  A6J51_RS12195 (A6J51_11845) - 2069512..2069937 (+) 426 WP_002220695.1 hypothetical protein -
  A6J51_RS12200 (A6J51_11850) - 2070168..2070368 (+) 201 WP_002219431.1 hypothetical protein -
  A6J51_RS12205 (A6J51_11855) - 2070436..2070795 (+) 360 WP_002220694.1 hypothetical protein -
  A6J51_RS12210 (A6J51_11860) - 2070820..2071674 (+) 855 WP_002220693.1 YfdQ family protein -
  A6J51_RS12215 (A6J51_11865) - 2071746..2071961 (+) 216 WP_002220692.1 hypothetical protein -
  A6J51_RS12220 (A6J51_11870) - 2071997..2072257 (+) 261 WP_002220690.1 NGO1622 family putative holin -
  A6J51_RS12225 (A6J51_11875) - 2072254..2072547 (+) 294 WP_002220689.1 hypothetical protein -
  A6J51_RS12230 (A6J51_11880) - 2072550..2072741 (+) 192 WP_002219435.1 type ISP restriction/modification enzyme -
  A6J51_RS12235 (A6J51_11885) - 2072741..2072881 (+) 141 WP_002220688.1 hypothetical protein -
  A6J51_RS12240 (A6J51_11890) - 2072878..2073087 (+) 210 WP_002220687.1 hypothetical protein -
  A6J51_RS12245 (A6J51_11895) - 2073145..2074062 (-) 918 WP_002220686.1 KilA-N domain-containing protein -
  A6J51_RS12250 (A6J51_11900) - 2074930..2075409 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  A6J51_RS12260 (A6J51_11910) - 2075844..2076224 (-) 381 WP_002220683.1 type II toxin-antitoxin system PemK/MazF family toxin -
  A6J51_RS12265 (A6J51_11915) - 2076377..2077573 (-) 1197 WP_080611321.1 integrase arm-type DNA-binding domain-containing protein -
  A6J51_RS12280 (A6J51_11930) yaaA 2078104..2078883 (-) 780 WP_002219439.1 peroxide stress protein YaaA -
  A6J51_RS14895 - 2078932..2079066 (-) 135 Protein_2004 IS5/IS1182 family transposase -
  A6J51_RS12285 (A6J51_11935) dapC 2079155..2080342 (-) 1188 WP_080611322.1 succinyldiaminopimelate transaminase -
  A6J51_RS12290 (A6J51_11940) dut 2080419..2080871 (-) 453 WP_057288628.1 dUTP diphosphatase -
  A6J51_RS12295 (A6J51_11945) - 2081019..2081447 (+) 429 Protein_2007 AzlC family ABC transporter permease -
  A6J51_RS12330 (A6J51_11980) pilL 2084847..2085344 (-) 498 WP_192941139.1 PilX family type IV pilin Machinery gene
  A6J51_RS12335 (A6J51_11985) pilK 2085349..2085942 (-) 594 WP_080611326.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  A6J51_RS12340 (A6J51_11990) pilJ 2085921..2086862 (-) 942 WP_080611327.1 PilW family protein Machinery gene
  A6J51_RS12345 (A6J51_11995) pilV 2086859..2087470 (-) 612 WP_181778298.1 type IV pilus modification protein PilV Machinery gene
  A6J51_RS12350 (A6J51_12000) pilH 2087494..2088171 (-) 678 WP_002213841.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  A6J51_RS12355 (A6J51_12005) dnaB 2088480..2089886 (-) 1407 WP_021438004.1 replicative DNA helicase -
  A6J51_RS12365 (A6J51_12015) - 2090050..2090637 (+) 588 WP_002213845.1 superoxide dismutase -
  A6J51_RS12380 (A6J51_12025) - 2091899..2092408 (-) 510 WP_002227434.1 isoprenylcysteine carboxyl methyltransferase family protein -
  A6J51_RS12385 (A6J51_12030) - 2092740..2093072 (-) 333 WP_002235681.1 hypothetical protein -
  A6J51_RS12395 (A6J51_12035) cysT 2093413..2094249 (+) 837 WP_080611376.1 sulfate ABC transporter permease subunit CysT -
  A6J51_RS12405 (A6J51_12045) cysW 2094619..2095479 (+) 861 WP_002220668.1 sulfate ABC transporter permease subunit CysW -
  A6J51_RS12410 (A6J51_12050) - 2095476..2096549 (+) 1074 WP_002232291.1 sulfate/molybdate ABC transporter ATP-binding protein -
  A6J51_RS12415 (A6J51_12055) ilvA 2096606..2098132 (-) 1527 WP_080542261.1 threonine ammonia-lyase, biosynthetic -
  A6J51_RS12425 (A6J51_12065) - 2098280..2099449 (+) 1170 WP_080542262.1 D-alanyl-D-alanine carboxypeptidase family protein -

Sequence

Protein


Download         Length: 165 a.a.        Molecular weight: 18195.03 Da        Isoelectric Point: 9.7322

>NTDB_id=222782 A6J51_RS12330 WP_192941139.1 2084847..2085344(-) (pilL) [Neisseria meningitidis strain FDAARGOS_212]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNTVKQIILKNPQDSNDILNIKLTMFVSGYKM
NPKIAEKYSVSGEFVDAPKSRANRALKSRAYRLVGVPKAGTGYTLSVWVNSVGDGYKCRDAVSARAYSETLSADAGCEAF
SNRKK

Nucleotide


Download         Length: 498 bp        

>NTDB_id=222782 A6J51_RS12330 WP_192941139.1 2084847..2085344(-) (pilL) [Neisseria meningitidis strain FDAARGOS_212]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTCGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATACTGTCAAAC
AGATTATTTTGAAAAATCCACAGGATAGTAATGATATCCTCAATATAAAACTGACAATGTTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCGAAAAATATAGTGTTTCGGGGGAATTTGTCGATGCGCCAAAATCAAGGGCAAACAGGGCGTTAAA
ATCAAGGGCATACAGGTTGGTCGGCGTTCCGAAGGCAGGGACGGGTTATACTTTGTCGGTATGGGTAAACAGCGTGGGCG
ACGGATACAAATGCCGTGATGCCGTTTCTGCCCGAGCCTATTCGGAGACTTTGTCCGCGGATGCCGGCTGTGAAGCTTTC
TCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-165)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

82.424

100

0.824
  pilX Neisseria meningitidis 8013

78.788

100

0.788

Multiple sequence alignment