Detailed information NTG0222646

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: A6J48_RS14300
• Genome accession: NZ_CP020420
• Coordinates: 1250558..1250683 (-)
• Length: 41 a.a.
• NCBI ID: WP_306807087.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain FDAARGOS_209
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1245558..1255683

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A6J48_RS07415 (A6J48_07290)	pilC	1247517..1250585 (-)	3069	Protein_1256	PilC family type IV pilus tip adhesin	-
A6J48_RS14300	pilC	1250558..1250683 (-)	126	WP_306807087.1	hypothetical protein	Machinery gene
A6J48_RS07420 (A6J48_07300)	-	1251245..1251529 (-)	285	WP_002246543.1	GIY-YIG nuclease family protein	-
A6J48_RS07435 (A6J48_07315)	pilA	1252118..1253383 (-)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
A6J48_RS07445 (A6J48_07325)	msrAB	1253529..1255097 (+)	1569	WP_082308717.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-

Sequence

Protein

• Length: 41 a.a.
• Molecular weight: 4825.73 Da
• Isoelectric Point: 12.8142

>NTDB_id=222646 A6J48_RS14300 WP_306807087.1 1250558..1250683(-) (pilC) [Neisseria meningitidis strain FDAARGOS_209]
MNKTWKRQVFRHTALYTAILMFSHTGGGGGRRKRKRIHTLL

Nucleotide

• Length: 126 bp

>NTDB_id=222646 A6J48_RS14300 WP_306807087.1 1250558..1250683(-) (pilC) [Neisseria meningitidis strain FDAARGOS_209]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGGGGCAGGCGCAAGCGCAAACGTATCCATACGCTCTTGTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	90	73.171	0.659