Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   A6J43_RS08285 Genome accession   NZ_CP020415
Coordinates   1423382..1423978 (-) Length   198 a.a.
NCBI ID   WP_082277593.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain FDAARGOS_204     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1384244..1437871 1423382..1423978 within 0


Gene organization within MGE regions


Location: 1384244..1437871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A6J43_RS08005 (A6J43_08040) - 1384244..1385089 (+) 846 WP_003701197.1 Bro-N domain-containing protein -
  A6J43_RS08010 (A6J43_08045) - 1385126..1385275 (-) 150 WP_003706419.1 hypothetical protein -
  A6J43_RS08015 (A6J43_08050) - 1385278..1385952 (-) 675 WP_003687998.1 hypothetical protein -
  A6J43_RS08020 (A6J43_08055) - 1385949..1386434 (-) 486 WP_003687997.1 hypothetical protein -
  A6J43_RS08025 (A6J43_08060) - 1386440..1386913 (-) 474 WP_003687996.1 hypothetical protein -
  A6J43_RS08030 (A6J43_08065) - 1386968..1388263 (-) 1296 WP_003695011.1 DUF4043 family protein -
  A6J43_RS08035 (A6J43_08070) - 1388284..1389021 (-) 738 WP_225577423.1 hypothetical protein -
  A6J43_RS14680 (A6J43_08075) - 1388946..1396197 (-) 7252 Protein_1395 PLxRFG domain-containing protein -
  A6J43_RS08050 (A6J43_08085) - 1396194..1397390 (-) 1197 WP_003693452.1 hypothetical protein -
  A6J43_RS08055 (A6J43_08090) - 1397628..1399895 (-) 2268 WP_225577699.1 hypothetical protein -
  A6J43_RS08060 (A6J43_08095) - 1399880..1401154 (-) 1275 WP_047919159.1 PBSX family phage terminase large subunit -
  A6J43_RS14200 - 1401135..1401674 (-) 540 WP_003690920.1 hypothetical protein -
  A6J43_RS08075 (A6J43_08110) - 1401674..1402096 (-) 423 WP_003690919.1 hypothetical protein -
  A6J43_RS08080 (A6J43_08115) - 1402161..1402679 (-) 519 WP_033910742.1 HNH endonuclease -
  A6J43_RS08085 (A6J43_08120) - 1402670..1403053 (-) 384 WP_003690918.1 recombination protein NinB -
  A6J43_RS08090 (A6J43_08125) - 1403050..1403355 (-) 306 WP_003687981.1 nuclease domain-containing protein -
  A6J43_RS08095 (A6J43_08130) - 1403348..1404058 (-) 711 WP_226882444.1 RusA family crossover junction endodeoxyribonuclease -
  A6J43_RS08100 (A6J43_08135) - 1404087..1404236 (-) 150 WP_003692854.1 hypothetical protein -
  A6J43_RS08110 (A6J43_08145) - 1404621..1405115 (-) 495 WP_003692852.1 DUF3310 domain-containing protein -
  A6J43_RS08115 (A6J43_08150) - 1405129..1405380 (-) 252 WP_003693465.1 hypothetical protein -
  A6J43_RS08120 (A6J43_08155) - 1405397..1406758 (-) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  A6J43_RS08125 (A6J43_08160) - 1406755..1407819 (-) 1065 WP_003693470.1 hypothetical protein -
  A6J43_RS08130 (A6J43_08165) - 1407937..1408164 (-) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  A6J43_RS08135 (A6J43_08170) - 1408337..1408525 (+) 189 WP_010951308.1 hypothetical protein -
  A6J43_RS08140 (A6J43_08175) - 1408502..1408657 (-) 156 WP_003698902.1 hypothetical protein -
  A6J43_RS08145 (A6J43_08180) - 1408737..1408967 (-) 231 WP_020997318.1 Cro/CI family transcriptional regulator -
  A6J43_RS08150 (A6J43_08185) - 1409096..1409758 (+) 663 WP_012503489.1 LexA family transcriptional regulator -
  A6J43_RS08155 (A6J43_08190) - 1409871..1410308 (+) 438 WP_003687967.1 hypothetical protein -
  A6J43_RS08160 (A6J43_08195) - 1410325..1410786 (+) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  A6J43_RS08165 (A6J43_08200) - 1410783..1411196 (+) 414 WP_003687963.1 hypothetical protein -
  A6J43_RS08170 (A6J43_08205) - 1411394..1411594 (+) 201 WP_003692842.1 hypothetical protein -
  A6J43_RS08175 (A6J43_08210) - 1411627..1412103 (+) 477 WP_002255718.1 DUF6948 domain-containing protein -
  A6J43_RS08180 (A6J43_08215) - 1412100..1412309 (+) 210 WP_082277588.1 hypothetical protein -
  A6J43_RS08185 (A6J43_08220) - 1412449..1412781 (+) 333 WP_105183567.1 hypothetical protein -
  A6J43_RS08190 (A6J43_08225) - 1412934..1413209 (+) 276 WP_003694990.1 NGO1622 family putative holin -
  A6J43_RS08195 (A6J43_08230) - 1413206..1413367 (+) 162 WP_003693867.1 hypothetical protein -
  A6J43_RS08200 (A6J43_08235) - 1413436..1414122 (+) 687 WP_033910330.1 phage replication initiation protein, NGO0469 family -
  A6J43_RS08205 (A6J43_08240) - 1414262..1414444 (+) 183 WP_003691535.1 hypothetical protein -
  A6J43_RS08210 (A6J43_08245) - 1414441..1414932 (+) 492 WP_082277471.1 siphovirus Gp157 family protein -
  A6J43_RS14585 - 1415231..1415497 (+) 267 Protein_1427 hypothetical protein -
  A6J43_RS08225 (A6J43_08260) - 1415778..1416461 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  A6J43_RS08230 (A6J43_08265) - 1416656..1416925 (+) 270 WP_003687928.1 hypothetical protein -
  A6J43_RS08235 (A6J43_08270) - 1416987..1417196 (+) 210 WP_047919504.1 lactate dehydrogenase -
  A6J43_RS08240 (A6J43_08275) - 1417283..1418476 (-) 1194 WP_017146746.1 phage integrase central domain-containing protein -
  A6J43_RS08255 (A6J43_08290) yaaA 1419006..1419785 (-) 780 WP_003692836.1 peroxide stress protein YaaA -
  A6J43_RS08260 (A6J43_08295) dapC 1419941..1421128 (-) 1188 WP_082277589.1 succinyldiaminopimelate transaminase -
  A6J43_RS08265 (A6J43_08300) dut 1421206..1421658 (-) 453 WP_003702446.1 dUTP diphosphatase -
  A6J43_RS13440 - 1421824..1422532 (+) 709 Protein_1435 AzlC family ABC transporter permease -
  A6J43_RS08275 (A6J43_08310) - 1422529..1422837 (+) 309 WP_050170999.1 AzlD family protein -
  A6J43_RS08280 (A6J43_08315) pilL 1422907..1423380 (-) 474 WP_192941126.1 PilX family type IV pilin Machinery gene
  A6J43_RS08285 (A6J43_08320) pilK 1423382..1423978 (-) 597 WP_082277593.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  A6J43_RS08290 (A6J43_08325) pilJ 1423957..1424919 (-) 963 WP_082277595.1 PilW family protein Machinery gene
  A6J43_RS08295 (A6J43_08330) pilI 1424916..1425524 (-) 609 WP_082277597.1 type IV pilus modification protein PilV Machinery gene
  A6J43_RS08300 (A6J43_08335) pilH 1425556..1426221 (-) 666 WP_050170995.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  A6J43_RS08310 (A6J43_08340) dnaB 1426529..1427935 (-) 1407 WP_047920816.1 replicative DNA helicase -
  A6J43_RS08315 (A6J43_08350) - 1428098..1428679 (+) 582 WP_003698180.1 superoxide dismutase -
  A6J43_RS08325 (A6J43_08360) - 1428909..1429418 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  A6J43_RS08330 (A6J43_08365) - 1429745..1430077 (-) 333 WP_003687908.1 hypothetical protein -
  A6J43_RS08335 (A6J43_08370) cysT 1430263..1431101 (+) 839 Protein_1446 sulfate ABC transporter permease subunit CysT -
  A6J43_RS08340 (A6J43_08375) cysW 1431290..1432150 (+) 861 WP_047918975.1 sulfate ABC transporter permease subunit CysW -
  A6J43_RS08345 (A6J43_08380) - 1432147..1433223 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -
  A6J43_RS08350 (A6J43_08385) ilvA 1433279..1434805 (-) 1527 WP_003690890.1 threonine ammonia-lyase, biosynthetic -
  A6J43_RS08355 (A6J43_08390) - 1434954..1436123 (+) 1170 WP_003687902.1 D-alanyl-D-alanine carboxypeptidase family protein -
  A6J43_RS08360 (A6J43_08395) - 1436249..1436821 (-) 573 WP_003687901.1 50S ribosomal protein L25/general stress protein Ctc -
  A6J43_RS08365 (A6J43_08400) - 1436888..1437871 (-) 984 WP_003687900.1 ribose-phosphate pyrophosphokinase -

Sequence


Protein


Download         Length: 198 a.a.        Molecular weight: 21557.35 Da        Isoelectric Point: 6.3622

>NTDB_id=222485 A6J43_RS08285 WP_082277593.1 1423382..1423978(-) (pilK) [Neisseria gonorrhoeae strain FDAARGOS_204]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCEKGLCTAVNVRTNNVNEESFGNIVVQGTSTVEAVKRSCPANSASLCIDNQGVEYKKGTGNVSKMPRYIIE
YLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 597 bp        

>NTDB_id=222485 A6J43_RS08285 WP_082277593.1 1423382..1423978(-) (pilK) [Neisseria gonorrhoeae strain FDAARGOS_204]
ATGCGCAAACAGAACACTTTGACGGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAGCAGCGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATGTTAATGA
AGAGTCTTTTGGCAATATCGTGGTGCAAGGCACGTCCACCGTTGAGGCCGTGAAGCGTTCTTGCCCTGCAAATTCTGCCA
GCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCGCGCTATATTATCGAA
TATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAATACCGTGGTCGT
CCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

93.103

100

0.955


Multiple sequence alignment