Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C2H91_RS15090 Genome accession   NZ_CP026030
Coordinates   3044625..3044765 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PK3_9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3039625..3049765
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H91_RS15060 (C2H91_15095) yueI 3039919..3040317 (+) 399 WP_032726794.1 YueI family protein -
  C2H91_RS15065 (C2H91_15100) pncA 3040414..3040965 (+) 552 WP_021480500.1 isochorismatase family cysteine hydrolase -
  C2H91_RS15070 (C2H91_15105) pncB 3040981..3042453 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C2H91_RS15075 (C2H91_15110) pdeH 3042590..3043819 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C2H91_RS15080 (C2H91_15115) - 3043795..3044163 (-) 369 WP_017695529.1 hypothetical protein -
  C2H91_RS15085 - 3044341..3044403 (-) 63 Protein_2936 hypothetical protein -
  C2H91_RS15090 (C2H91_15120) degQ 3044625..3044765 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C2H91_RS15095 (C2H91_15125) comQ 3044950..3045810 (+) 861 WP_032677058.1 polyprenyl synthetase family protein Regulator
  C2H91_RS15100 (C2H91_15130) comX 3045825..3045986 (+) 162 WP_049140565.1 competence pheromone ComX -
  C2H91_RS15105 (C2H91_15135) comP 3045994..3048291 (+) 2298 WP_141949158.1 histidine kinase Regulator
  C2H91_RS15110 (C2H91_15140) comA 3048372..3049016 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C2H91_RS15115 (C2H91_15145) yuxO 3049035..3049415 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=222091 C2H91_RS15090 WP_003220708.1 3044625..3044765(+) (degQ) [Bacillus subtilis strain PK3_9]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=222091 C2H91_RS15090 WP_003220708.1 3044625..3044765(+) (degQ) [Bacillus subtilis strain PK3_9]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1