Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BS21228_RS06510 Genome accession   NZ_CP020023
Coordinates   1192415..1192555 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ATCC 21228     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1187415..1197555
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS21228_RS06485 (BS21228_06440) yuxO 1187692..1188072 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  BS21228_RS06490 (BS21228_06445) comA 1188091..1188735 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BS21228_RS06495 (BS21228_06450) comP 1188816..1191128 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  BS21228_RS06500 (BS21228_06455) comX 1191144..1191365 (-) 222 WP_014480704.1 competence pheromone ComX -
  BS21228_RS06505 (BS21228_06460) - 1191367..1192230 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  BS21228_RS06510 (BS21228_06465) degQ 1192415..1192555 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BS21228_RS22775 - 1192777..1192902 (+) 126 WP_003228793.1 hypothetical protein -
  BS21228_RS06515 (BS21228_06470) - 1193016..1193384 (+) 369 WP_014477834.1 hypothetical protein -
  BS21228_RS06520 (BS21228_06475) pdeH 1193360..1194589 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  BS21228_RS06525 (BS21228_06480) pncB 1194725..1196197 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  BS21228_RS06530 (BS21228_06485) pncA 1196213..1196764 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  BS21228_RS06535 (BS21228_06490) yueI 1196861..1197259 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=220326 BS21228_RS06510 WP_003220708.1 1192415..1192555(-) (degQ) [Bacillus subtilis strain ATCC 21228]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=220326 BS21228_RS06510 WP_003220708.1 1192415..1192555(-) (degQ) [Bacillus subtilis strain ATCC 21228]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment