Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CYK58_RS00755 Genome accession   NZ_CP025474
Coordinates   152962..153087 (+) Length   41 a.a.
NCBI ID   WP_021307643.1    Uniprot ID   -
Organism   Helicobacter pylori strain H-137     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147962..158087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CYK58_RS00730 (CYK58_00730) - 148022..150244 (+) 2223 WP_126130755.1 ATP-dependent Clp protease ATP-binding subunit -
  CYK58_RS00735 (CYK58_00735) panD 150234..150584 (+) 351 WP_126130756.1 aspartate 1-decarboxylase -
  CYK58_RS00740 (CYK58_00740) - 150595..150888 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  CYK58_RS00745 (CYK58_00745) - 150888..151883 (+) 996 WP_126131605.1 PDZ domain-containing protein -
  CYK58_RS00750 (CYK58_00750) comB6 151891..152946 (+) 1056 WP_126131604.1 P-type conjugative transfer protein TrbL Machinery gene
  CYK58_RS00755 (CYK58_00755) comB7 152962..153087 (+) 126 WP_021307643.1 hypothetical protein Machinery gene
  CYK58_RS00760 (CYK58_00760) comB8 153084..153827 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  CYK58_RS00765 (CYK58_00765) comB9 153827..154792 (+) 966 WP_126130757.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CYK58_RS00770 (CYK58_00770) comB10 154785..155921 (+) 1137 WP_126130758.1 DNA type IV secretion system protein ComB10 Machinery gene
  CYK58_RS00775 (CYK58_00775) - 155991..157403 (+) 1413 WP_126130759.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4780.79 Da        Isoelectric Point: 9.3278

>NTDB_id=219014 CYK58_RS00755 WP_021307643.1 152962..153087(+) (comB7) [Helicobacter pylori strain H-137]
MRIFFVIMGLVLFGCTSKVHEIKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=219014 CYK58_RS00755 WP_021307643.1 152962..153087(+) (comB7) [Helicobacter pylori strain H-137]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATAAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854


Multiple sequence alignment