Detailed information NTG0217673

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: CXG95_RS07025
• Genome accession: NZ_CP025226
• Coordinates: 1345649..1346086 (+)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain PB3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1340649..1351086

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CXG95_RS06990 (CXG95_06995)	-	1341305..1341550 (-)	246	WP_003183483.1	DUF2626 domain-containing protein	-
CXG95_RS06995 (CXG95_07000)	-	1341759..1342136 (+)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
CXG95_RS07005 (CXG95_07010)	-	1342378..1343217 (+)	840	WP_003183480.1	STAS domain-containing protein	-
CXG95_RS07010 (CXG95_07015)	comGA	1343374..1344312 (+)	939	WP_061565980.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
CXG95_RS07015 (CXG95_07020)	comGB	1344302..1345336 (+)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
CXG95_RS07020 (CXG95_07025)	comGC	1345350..1345643 (+)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
CXG95_RS07025 (CXG95_07030)	comGD	1345649..1346086 (+)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
CXG95_RS07030 (CXG95_07035)	comGE	1346070..1346417 (+)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
CXG95_RS07035 (CXG95_07040)	comGF	1346443..1346814 (+)	372	WP_003183461.1	competence type IV pilus minor pilin ComGF	Machinery gene
CXG95_RS07040 (CXG95_07045)	comGG	1346827..1347192 (+)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
CXG95_RS07045 (CXG95_07050)	-	1347281..1347463 (+)	183	WP_003183456.1	YqzE family protein	-
CXG95_RS07050 (CXG95_07055)	-	1347487..1347774 (-)	288	WP_223307118.1	YqzG/YhdC family protein	-
CXG95_RS07055 (CXG95_07060)	tapA	1348084..1348812 (+)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
CXG95_RS07060 (CXG95_07065)	-	1348809..1349393 (+)	585	WP_003183449.1	signal peptidase I	-
CXG95_RS07065 (CXG95_07070)	-	1349467..1350261 (+)	795	WP_003183447.1	TasA family protein	-
CXG95_RS07070 (CXG95_07075)	sinR	1350366..1350701 (-)	336	WP_025804940.1	helix-turn-helix domain-containing protein	Regulator
CXG95_RS07075 (CXG95_07080)	sinI	1350735..1350911 (-)	177	WP_003183444.1	anti-repressor SinI family protein	Regulator

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=217673 CXG95_RS07025 WP_009327905.1 1345649..1346086(+) (comGD) [Bacillus licheniformis strain PB3]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=217673 CXG95_RS07025 WP_009327905.1 1345649..1346086(+) (comGD) [Bacillus licheniformis strain PB3]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393