Detailed information NTG0217615

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: CW339_RS08950
• Genome accession: NZ_CP025216
• Coordinates: 1695613..1695930 (-)
• Length: 105 a.a.
• NCBI ID: WP_011681685.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain DGCC 7710
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1690613..1700930

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CW339_RS08915 (CW339_08915)	-	1690971..1691633 (-)	663	WP_011681679.1	type II CAAX endopeptidase family protein	-
CW339_RS08920 (CW339_08920)	-	1691730..1692173 (-)	444	WP_011681680.1	hypothetical protein	-
CW339_RS10580 (CW339_08925)	-	1692247..1692672 (-)	426	WP_014608739.1	CPBP family intramembrane glutamic endopeptidase	-
CW339_RS10585 (CW339_08930)	-	1692629..1692904 (-)	276	WP_011681681.1	hypothetical protein	-
CW339_RS08935 (CW339_08935)	-	1692916..1693114 (-)	199	Protein_1673	helix-turn-helix transcriptional regulator	-
CW339_RS08940 (CW339_08940)	-	1693363..1694556 (-)	1194	WP_014608740.1	acetate kinase	-
CW339_RS08945 (CW339_08945)	comGH	1694612..1695568 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
CW339_RS08950 (CW339_08950)	comGG	1695613..1695930 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	Machinery gene
CW339_RS08955 (CW339_08955)	comGF	1695908..1696345 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
CW339_RS08960 (CW339_08960)	comGE	1696329..1696622 (-)	294	WP_024704238.1	competence type IV pilus minor pilin ComGE	Machinery gene
CW339_RS08965 (CW339_08965)	comGD	1696594..1697022 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
CW339_RS08970 (CW339_08970)	comGC	1696982..1697308 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
CW339_RS08975 (CW339_08975)	comGB	1697305..1698405 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
CW339_RS08980 (CW339_08980)	comGA/cglA/cilD	1698287..1699228 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
CW339_RS08985 (CW339_08985)	-	1699309..1699671 (-)	363	WP_014622006.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11851.01 Da
• Isoelectric Point: 10.6334

>NTDB_id=217615 CW339_RS08950 WP_011681685.1 1695613..1695930(-) (comGG) [Streptococcus thermophilus strain DGCC 7710]
MLLKKQVRGGVLLYALFMAGIFILLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVVVRVVSKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=217615 CW339_RS08950 WP_011681685.1 1695613..1695930(-) (comGG) [Streptococcus thermophilus strain DGCC 7710]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTATACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGGTTGTCAGAGTTGTCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae TIGR4	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae D39	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae R6	43.333	85.714	0.371
comGG/cglG	Streptococcus mitis NCTC 12261	42.222	85.714	0.362