Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BZ167_RS14455 Genome accession   NZ_CP019626
Coordinates   2961507..2961647 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. 275     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2956507..2966647
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BZ167_RS14425 (BZ167_14475) - 2956813..2957211 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  BZ167_RS14430 (BZ167_14480) - 2957308..2957859 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BZ167_RS14435 (BZ167_14485) - 2957877..2959343 (+) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  BZ167_RS14440 (BZ167_14490) - 2959473..2960696 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BZ167_RS14445 (BZ167_14495) - 2960703..2961044 (-) 342 WP_015418107.1 hypothetical protein -
  BZ167_RS14455 (BZ167_14505) degQ 2961507..2961647 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BZ167_RS14460 (BZ167_14510) - 2961778..2962707 (+) 930 WP_224462816.1 polyprenyl synthetase family protein -
  BZ167_RS14465 (BZ167_14515) comX 2962704..2962874 (+) 171 WP_015418105.1 competence pheromone ComX -
  BZ167_RS14470 (BZ167_14520) comP 2962852..2965203 (+) 2352 WP_015418104.1 histidine kinase Regulator
  BZ167_RS14475 (BZ167_14525) comA 2965284..2965928 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  BZ167_RS14480 (BZ167_14530) - 2965950..2966333 (+) 384 WP_061860832.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=217368 BZ167_RS14455 WP_003152043.1 2961507..2961647(+) (degQ) [Bacillus sp. 275]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=217368 BZ167_RS14455 WP_003152043.1 2961507..2961647(+) (degQ) [Bacillus sp. 275]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment