Detailed information NTG0021670

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: NMA_RS14895
• Genome accession: NC_003116
• Coordinates: 279084..279215 (+)
• Length: 43 a.a.
• NCBI ID: WP_306808038.1
• Uniprot ID: -
• Organism: Neisseria meningitidis Z2491
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 274084..284215

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NMA_RS01530 (NMA0290)	msrAB	274600..276168 (-)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
NMA_RS01535 (NMA0291)	pilA	276314..277579 (+)	1266	WP_002247114.1	signal recognition particle-docking protein FtsY	Machinery gene
NMA_RS01540 (NMA0292)	-	278168..278452 (+)	285	WP_002246543.1	GIY-YIG nuclease family protein	-
NMA_RS14895	pilC	279084..279215 (+)	132	WP_306808038.1	hypothetical protein	Machinery gene
NMA_RS01545 (NMA0293)	pilC	279185..282250 (+)	3066	Protein_282	PilC family type IV pilus tip adhesin	-

Sequence

Protein

• Length: 43 a.a.
• Molecular weight: 5087.06 Da
• Isoelectric Point: 12.9102

>NTDB_id=21670 NMA_RS14895 WP_306808038.1 279084..279215(+) (pilC) [Neisseria meningitidis Z2491]
MNKTWKRQVFRHTALYTAILMFSHTGGGGGRRKRKRKRINTLL

Nucleotide

• Length: 132 bp

>NTDB_id=21670 NMA_RS14895 WP_306808038.1 279084..279215(+) (pilC) [Neisseria meningitidis Z2491]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGGGGCAGGCGCAAGCGCAAACGCAAACGCATAAATACGCTATTGTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	90	69.767	0.628