Detailed information NTG0215992

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: BZG33_RS14540
• Genome accession: NZ_CP019466
• Coordinates: 56268..56390 (-)
• Length: 40 a.a.
• NCBI ID: WP_306807989.1
• Uniprot ID: -
• Organism: Neisseria gonorrhoeae strain RIVM0610
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 51268..61390

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BZG33_RS00325 (BZG33_00325)	pilC	53239..56268 (-)	3030	WP_025455759.1	PilC family type IV pilus tip adhesin	Machinery gene
BZG33_RS14540	pilC	56268..56390 (-)	123	WP_306807989.1	hypothetical protein	Machinery gene
BZG33_RS00345 (BZG33_00345)	apbC	57799..58878 (-)	1080	WP_003699443.1	iron-sulfur cluster carrier protein ApbC	-
BZG33_RS00355 (BZG33_00355)	-	59252..59761 (+)	510	WP_003687293.1	protein disulfide oxidoreductase	-
BZG33_RS00365 (BZG33_00360)	nadR	60102..60542 (+)	441	WP_003687296.1	MarR family adhesin repressor NadR	-
BZG33_RS00370 (BZG33_00365)	hpaC	60657..61157 (+)	501	WP_003687298.1	4-hydroxyphenylacetate 3-monooxygenase, reductase component	-

Sequence

Protein

• Length: 40 a.a.
• Molecular weight: 4698.63 Da
• Isoelectric Point: 12.9831

>NTDB_id=215992 BZG33_RS14540 WP_306807989.1 56268..56390(-) (pilC) [Neisseria gonorrhoeae strain RIVM0610]
MNKTLKRRVFRHTALYAAILMFSHTGGGGRRRRKRINTLL

Nucleotide

• Length: 123 bp

>NTDB_id=215992 BZG33_RS14540 WP_306807989.1 56268..56390(-) (pilC) [Neisseria gonorrhoeae strain RIVM0610]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GGGGGGCAGGCGCAGGCGCAAACGTATAAATACGCTATTGTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	96.552	72.5	0.7