Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CV727_RS07500 Genome accession   NZ_CP024949
Coordinates   1521551..1521664 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain B136A     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1516551..1526664
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV727_RS07480 (CV727_07475) - 1517219..1518631 (-) 1413 WP_145821307.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  CV727_RS07485 (CV727_07480) comB10 1518702..1519838 (-) 1137 WP_145821308.1 DNA type IV secretion system protein ComB10 Machinery gene
  CV727_RS07490 (CV727_07485) comB9 1519831..1520811 (-) 981 WP_145821310.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CV727_RS07495 (CV727_07490) comB8 1520811..1521554 (-) 744 WP_000660569.1 virB8 family protein Machinery gene
  CV727_RS07500 (CV727_07495) comB7 1521551..1521664 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  CV727_RS07505 (CV727_07500) comB6 1521680..1522735 (-) 1056 WP_145821557.1 P-type conjugative transfer protein TrbL Machinery gene
  CV727_RS07510 (CV727_07505) - 1522743..1523747 (-) 1005 WP_145821312.1 PDZ domain-containing protein -
  CV727_RS07515 (CV727_07510) - 1523747..1524049 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  CV727_RS07520 (CV727_07515) panD 1524052..1524405 (-) 354 WP_108338030.1 aspartate 1-decarboxylase -
  CV727_RS07525 (CV727_07520) - 1524395..1526620 (-) 2226 WP_145821314.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=215408 CV727_RS07500 WP_001217873.1 1521551..1521664(-) (comB7) [Helicobacter pylori strain B136A]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=215408 CV727_RS07500 WP_001217873.1 1521551..1521664(-) (comB7) [Helicobacter pylori strain B136A]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1