Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BVH55_RS15890 Genome accession   NZ_CP019040
Coordinates   3138047..3138187 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GH1-13     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3133047..3143187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVH55_RS15865 (BVH55_15900) - 3133387..3133770 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  BVH55_RS15870 (BVH55_15905) comA 3133792..3134436 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BVH55_RS15875 (BVH55_15910) comP 3134517..3136808 (-) 2292 WP_077722768.1 histidine kinase Regulator
  BVH55_RS15880 (BVH55_15915) comX 3136820..3136984 (-) 165 WP_007613432.1 competence pheromone ComX -
  BVH55_RS15885 (BVH55_15920) - 3136984..3137895 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  BVH55_RS15890 (BVH55_15925) degQ 3138047..3138187 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BVH55_RS15900 (BVH55_15935) - 3138652..3138993 (+) 342 WP_014305721.1 hypothetical protein -
  BVH55_RS15905 (BVH55_15940) - 3139000..3140220 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  BVH55_RS15910 (BVH55_15945) - 3140350..3141816 (-) 1467 WP_154066736.1 nicotinate phosphoribosyltransferase -
  BVH55_RS15915 (BVH55_15950) - 3141834..3142385 (-) 552 WP_077722769.1 isochorismatase family cysteine hydrolase -
  BVH55_RS15920 (BVH55_15955) - 3142482..3142880 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=212776 BVH55_RS15890 WP_003152043.1 3138047..3138187(-) (degQ) [Bacillus velezensis strain GH1-13]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=212776 BVH55_RS15890 WP_003152043.1 3138047..3138187(-) (degQ) [Bacillus velezensis strain GH1-13]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment