Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BVH55_RS15890 | Genome accession | NZ_CP019040 |
| Coordinates | 3138047..3138187 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain GH1-13 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3133047..3143187
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVH55_RS15865 (BVH55_15900) | - | 3133387..3133770 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| BVH55_RS15870 (BVH55_15905) | comA | 3133792..3134436 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| BVH55_RS15875 (BVH55_15910) | comP | 3134517..3136808 (-) | 2292 | WP_077722768.1 | histidine kinase | Regulator |
| BVH55_RS15880 (BVH55_15915) | comX | 3136820..3136984 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| BVH55_RS15885 (BVH55_15920) | - | 3136984..3137895 (-) | 912 | WP_031378407.1 | polyprenyl synthetase family protein | - |
| BVH55_RS15890 (BVH55_15925) | degQ | 3138047..3138187 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| BVH55_RS15900 (BVH55_15935) | - | 3138652..3138993 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| BVH55_RS15905 (BVH55_15940) | - | 3139000..3140220 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| BVH55_RS15910 (BVH55_15945) | - | 3140350..3141816 (-) | 1467 | WP_154066736.1 | nicotinate phosphoribosyltransferase | - |
| BVH55_RS15915 (BVH55_15950) | - | 3141834..3142385 (-) | 552 | WP_077722769.1 | isochorismatase family cysteine hydrolase | - |
| BVH55_RS15920 (BVH55_15955) | - | 3142482..3142880 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=212776 BVH55_RS15890 WP_003152043.1 3138047..3138187(-) (degQ) [Bacillus velezensis strain GH1-13]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=212776 BVH55_RS15890 WP_003152043.1 3138047..3138187(-) (degQ) [Bacillus velezensis strain GH1-13]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |