Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BVH55_RS12860 | Genome accession | NZ_CP019040 |
| Coordinates | 2577668..2577841 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain GH1-13 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2572668..2582841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVH55_RS12845 (BVH55_12875) | gcvT | 2573485..2574585 (-) | 1101 | WP_077722591.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BVH55_RS12850 (BVH55_12880) | - | 2575009..2576679 (+) | 1671 | WP_046559872.1 | SNF2-related protein | - |
| BVH55_RS12855 (BVH55_12885) | - | 2576697..2577491 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| BVH55_RS12860 (BVH55_12890) | sinI | 2577668..2577841 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BVH55_RS12865 (BVH55_12895) | sinR | 2577875..2578210 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BVH55_RS12870 (BVH55_12900) | tasA | 2578258..2579043 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BVH55_RS12875 (BVH55_12905) | sipW | 2579107..2579691 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| BVH55_RS12880 (BVH55_12910) | tapA | 2579663..2580334 (-) | 672 | WP_070082109.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BVH55_RS12885 (BVH55_12915) | - | 2580593..2580922 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| BVH55_RS12890 (BVH55_12920) | - | 2580962..2581141 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BVH55_RS12895 (BVH55_12925) | comGG | 2581198..2581575 (-) | 378 | WP_077722592.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BVH55_RS12900 (BVH55_12930) | comGF | 2581576..2582076 (-) | 501 | WP_232213409.1 | competence type IV pilus minor pilin ComGF | - |
| BVH55_RS12905 (BVH55_12935) | comGE | 2581985..2582299 (-) | 315 | WP_077722594.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BVH55_RS12910 (BVH55_12940) | comGD | 2582283..2582720 (-) | 438 | WP_077722595.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=212754 BVH55_RS12860 WP_003153105.1 2577668..2577841(+) (sinI) [Bacillus velezensis strain GH1-13]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=212754 BVH55_RS12860 WP_003153105.1 2577668..2577841(+) (sinI) [Bacillus velezensis strain GH1-13]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |