Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   BVH55_RS12905 Genome accession   NZ_CP019040
Coordinates   2581985..2582299 (-) Length   104 a.a.
NCBI ID   WP_077722594.1    Uniprot ID   -
Organism   Bacillus velezensis strain GH1-13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2576985..2587299
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVH55_RS12860 (BVH55_12890) sinI 2577668..2577841 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BVH55_RS12865 (BVH55_12895) sinR 2577875..2578210 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BVH55_RS12870 (BVH55_12900) tasA 2578258..2579043 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BVH55_RS12875 (BVH55_12905) sipW 2579107..2579691 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BVH55_RS12880 (BVH55_12910) tapA 2579663..2580334 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  BVH55_RS12885 (BVH55_12915) - 2580593..2580922 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  BVH55_RS12890 (BVH55_12920) - 2580962..2581141 (-) 180 WP_003153093.1 YqzE family protein -
  BVH55_RS12895 (BVH55_12925) comGG 2581198..2581575 (-) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  BVH55_RS12900 (BVH55_12930) comGF 2581576..2582076 (-) 501 WP_232213409.1 competence type IV pilus minor pilin ComGF -
  BVH55_RS12905 (BVH55_12935) comGE 2581985..2582299 (-) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  BVH55_RS12910 (BVH55_12940) comGD 2582283..2582720 (-) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  BVH55_RS12915 (BVH55_12945) comGC 2582710..2583018 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  BVH55_RS12920 (BVH55_12950) comGB 2583023..2584060 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  BVH55_RS12925 (BVH55_12955) comGA 2584047..2585117 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  BVH55_RS12930 (BVH55_12960) - 2585309..2586259 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11860.84 Da        Isoelectric Point: 6.9470

>NTDB_id=212757 BVH55_RS12905 WP_077722594.1 2581985..2582299(-) (comGE) [Bacillus velezensis strain GH1-13]
MLNGNKGFSTIETLSAMSIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=212757 BVH55_RS12905 WP_077722594.1 2581985..2582299(-) (comGE) [Bacillus velezensis strain GH1-13]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGTCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49

Multiple sequence alignment