Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BUN12_RS07970 | Genome accession | NZ_CP018902 |
| Coordinates | 1544084..1544257 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain HK1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1539084..1549257
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BUN12_RS07955 (BUN12_1573) | gcvT | 1539895..1540995 (-) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BUN12_RS07960 (BUN12_1574) | - | 1541419..1543089 (+) | 1671 | WP_014470658.1 | DEAD/DEAH box helicase | - |
| BUN12_RS07965 (BUN12_1575) | - | 1543110..1543904 (+) | 795 | WP_013352859.1 | YqhG family protein | - |
| BUN12_RS07970 (BUN12_1576) | sinI | 1544084..1544257 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| BUN12_RS07975 (BUN12_1577) | sinR | 1544291..1544626 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| BUN12_RS07980 (BUN12_1578) | tasA | 1544674..1545459 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| BUN12_RS07985 (BUN12_1579) | sipW | 1545524..1546108 (-) | 585 | WP_013352863.1 | signal peptidase I SipW | - |
| BUN12_RS07990 (BUN12_1580) | tapA | 1546080..1546751 (-) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BUN12_RS07995 (BUN12_1581) | - | 1547009..1547338 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| BUN12_RS08000 (BUN12_1582) | - | 1547379..1547558 (-) | 180 | WP_013352866.1 | YqzE family protein | - |
| BUN12_RS08005 (BUN12_1583) | comGG | 1547612..1547989 (-) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BUN12_RS08010 | comGF | 1547991..1548491 (-) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| BUN12_RS08015 (BUN12_1585) | comGE | 1548400..1548714 (-) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BUN12_RS08020 (BUN12_1586) | comGD | 1548698..1549135 (-) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=211524 BUN12_RS07970 WP_013352860.1 1544084..1544257(+) (sinI) [Bacillus amyloliquefaciens strain HK1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=211524 BUN12_RS07970 WP_013352860.1 1544084..1544257(+) (sinI) [Bacillus amyloliquefaciens strain HK1]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |