Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BS467_RS09215 | Genome accession | NZ_CP018574 |
| Coordinates | 1800538..1800678 (+) | Length | 46 a.a. |
| NCBI ID | WP_003213123.1 | Uniprot ID | A0A5K1N966 |
| Organism | Bacillus altitudinis strain GLB197 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1795538..1805678
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BS467_RS09190 (BS467_09195) | - | 1795769..1796176 (+) | 408 | WP_007500468.1 | YueI family protein | - |
| BS467_RS09195 (BS467_09200) | - | 1796237..1796788 (+) | 552 | WP_008345872.1 | cysteine hydrolase family protein | - |
| BS467_RS09200 (BS467_09205) | - | 1796806..1798275 (+) | 1470 | WP_017358937.1 | nicotinate phosphoribosyltransferase | - |
| BS467_RS09205 (BS467_09210) | - | 1798416..1799642 (+) | 1227 | WP_035701209.1 | EAL and HDOD domain-containing protein | - |
| BS467_RS09210 (BS467_09215) | - | 1799679..1800032 (-) | 354 | WP_019744042.1 | hypothetical protein | - |
| BS467_RS09215 (BS467_09220) | degQ | 1800538..1800678 (+) | 141 | WP_003213123.1 | degradation enzyme regulation protein DegQ | Regulator |
| BS467_RS09220 (BS467_09225) | - | 1800830..1801744 (+) | 915 | WP_060832601.1 | polyprenyl synthetase family protein | - |
| BS467_RS09225 (BS467_09230) | comX | 1801741..1801911 (+) | 171 | WP_074041927.1 | competence pheromone ComX | - |
| BS467_RS09230 (BS467_09235) | comP | 1801952..1804264 (+) | 2313 | WP_035701206.1 | ATP-binding protein | Regulator |
| BS467_RS09235 (BS467_09240) | comA | 1804345..1804986 (+) | 642 | WP_007500477.1 | response regulator transcription factor | Regulator |
| BS467_RS09240 (BS467_09245) | - | 1805010..1805399 (+) | 390 | WP_017358943.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5677.42 Da Isoelectric Point: 4.6828
>NTDB_id=208980 BS467_RS09215 WP_003213123.1 1800538..1800678(+) (degQ) [Bacillus altitudinis strain GLB197]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=208980 BS467_RS09215 WP_003213123.1 1800538..1800678(+) (degQ) [Bacillus altitudinis strain GLB197]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
68.085 |
100 |
0.696 |