Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   COO52_RS06755 Genome accession   NZ_CP023448
Coordinates   1356199..1356324 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain HPJP26     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1351199..1361324
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  COO52_RS06735 - 1351883..1353295 (-) 1413 WP_096479145.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  COO52_RS06740 comB10 1353365..1354501 (-) 1137 WP_096479146.1 DNA type IV secretion system protein ComB10 Machinery gene
  COO52_RS06745 comB9 1354494..1355459 (-) 966 WP_096479147.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  COO52_RS06750 comB8 1355459..1356202 (-) 744 WP_000660524.1 type IV secretion system protein Machinery gene
  COO52_RS06755 comB7 1356199..1356324 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  COO52_RS06760 comB6 1356340..1357395 (-) 1056 WP_096479148.1 P-type conjugative transfer protein TrbL Machinery gene
  COO52_RS06765 - 1357401..1358396 (-) 996 WP_096413487.1 PDZ domain-containing protein -
  COO52_RS06770 - 1358396..1358689 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  COO52_RS06775 panD 1358700..1359050 (-) 351 WP_096479149.1 aspartate 1-decarboxylase -
  COO52_RS06780 - 1359040..1361262 (-) 2223 WP_096479150.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=207287 COO52_RS06755 WP_001217874.1 1356199..1356324(-) (comB7) [Helicobacter pylori strain HPJP26]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=207287 COO52_RS06755 WP_001217874.1 1356199..1356324(-) (comB7) [Helicobacter pylori strain HPJP26]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878